Homologs in group_1219

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07095 FBDBKF_07095 98.8 Morganella morganii S1 lrp leucine-responsive transcriptional regulator Lrp
EHELCC_03875 EHELCC_03875 98.8 Morganella morganii S2 lrp leucine-responsive transcriptional regulator Lrp
NLDBIP_03875 NLDBIP_03875 98.8 Morganella morganii S4 lrp leucine-responsive transcriptional regulator Lrp
LHKJJB_09705 LHKJJB_09705 98.8 Morganella morganii S3 lrp leucine-responsive transcriptional regulator Lrp
HKOGLL_09270 HKOGLL_09270 98.8 Morganella morganii S5 lrp leucine-responsive transcriptional regulator Lrp
F4V73_RS01280 F4V73_RS01280 98.8 Morganella psychrotolerans lrp leucine-responsive transcriptional regulator Lrp

Distribution of the homologs in the orthogroup group_1219

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1219

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ACJ3 6.11e-116 328 97 0 164 3 lrp Leucine-responsive regulatory protein Shigella flexneri
P0ACJ4 6.11e-116 328 97 0 164 3 lrp Leucine-responsive regulatory protein Klebsiella aerogenes
P0ACJ0 6.11e-116 328 97 0 164 1 lrp Leucine-responsive regulatory protein Escherichia coli (strain K12)
P0ACJ1 6.11e-116 328 97 0 164 3 lrp Leucine-responsive regulatory protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACJ2 6.11e-116 328 97 0 164 3 lrp Leucine-responsive regulatory protein Escherichia coli O157:H7
P0A2S0 6.38e-116 327 97 0 164 3 lrp Leucine-responsive regulatory protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P37424 6.89e-116 327 97 0 164 3 lrp Leucine-responsive regulatory protein Klebsiella pneumoniae
P37425 1.54e-115 327 97 0 164 3 lrp Leucine-responsive regulatory protein Serratia marcescens
P45265 2.08e-85 250 77 0 158 3 lrp Leucine-responsive regulatory protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q44333 2.6e-47 154 47 0 147 4 putR Proline dehydrogenase transcriptional activator Rhizobium radiobacter
Q52710 3.83e-41 138 45 0 146 4 putR Proline dehydrogenase transcriptional activator Rhodobacter capsulatus
P42179 7.52e-31 112 38 1 150 4 bkdR Bkd operon transcriptional regulator Pseudomonas putida
Q9I1M3 8.57e-30 109 38 0 143 3 bkdR Bkd operon transcriptional regulator Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P56901 4.29e-29 107 37 0 151 3 lrp Leucine-responsive regulatory protein Rhizobium meliloti (strain 1021)
E1V7V9 7e-28 104 39 0 144 3 doeX Transcriptional regulatory protein DoeX Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)
O07920 2.9e-26 100 33 0 148 4 azlB Transcriptional regulator AzlB Bacillus subtilis (strain 168)
P50337 2.87e-24 94 41 0 104 4 NGR_a01600 Uncharacterized HTH-type transcriptional regulator y4sM Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P0ACJ5 3.06e-24 95 32 0 151 1 decR DNA-binding transcriptional activator DecR Escherichia coli (strain K12)
P0ACJ6 3.06e-24 95 32 0 151 3 decR DNA-binding transcriptional activator DecR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACJ7 3.06e-24 95 32 0 151 3 decR DNA-binding transcriptional activator DecR Escherichia coli O157:H7
Q9V0Y9 1.75e-22 90 34 2 152 3 fl11 HTH-type transcriptional regulator FL11 Pyrococcus abyssi (strain GE5 / Orsay)
F8DT24 1.94e-22 90 33 1 148 4 zrp HTH-type transcriptional regulator Zrp Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1)
P0DJA6 4.85e-22 89 33 1 148 4 zrp HTH-type transcriptional regulator Zrp Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
P55658 1.4e-20 86 30 0 146 4 NGR_a01550 Uncharacterized HTH-type transcriptional regulator y4tD Sinorhizobium fredii (strain NBRC 101917 / NGR234)
F8DT92 3.02e-20 85 35 1 148 4 grp Glutamate uptake regulatory protein Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1)
P0DJA5 3.09e-20 85 35 1 148 3 grp Glutamate uptake regulatory protein Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
O59188 5.79e-20 84 31 2 151 1 fl11 HTH-type transcriptional regulator FL11 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q8U0P3 3.94e-19 82 31 2 151 3 fl11 HTH-type transcriptional regulator FL11 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
P44580 3.64e-18 79 33 1 138 4 HI_0224 Uncharacterized HTH-type transcriptional regulator HI_0224 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P96582 2.51e-17 77 32 2 146 1 lrpC HTH-type transcriptional regulator LrpC Bacillus subtilis (strain 168)
Q9V2D7 1.21e-16 75 31 1 138 4 PYRAB01370 Uncharacterized HTH-type transcriptional regulator PYRAB01370 Pyrococcus abyssi (strain GE5 / Orsay)
Q8U4M7 1.75e-16 75 32 0 120 4 PF0054 Uncharacterized HTH-type transcriptional regulator PF0054 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
O57880 2.39e-16 74 28 1 139 1 PH0140 Uncharacterized HTH-type transcriptional regulator PH0140 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q8U445 1.04e-14 70 30 0 144 4 PF0250 Uncharacterized HTH-type transcriptional regulator PF0250 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q9UY16 1.36e-13 67 28 0 144 4 PYRAB16920 Uncharacterized HTH-type transcriptional regulator PYRAB16920 Pyrococcus abyssi (strain GE5 / Orsay)
Q57615 2.94e-13 66 28 1 150 1 ptr1 HTH-type transcriptional regulator Ptr1 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O59579 4.49e-13 66 28 0 144 4 PH1916 Uncharacterized HTH-type transcriptional regulator PH1916 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
P42180 9.2e-13 65 28 1 143 1 lrpA HTH-type transcriptional regulator LrpA Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
O57818 1.44e-12 64 28 4 149 4 PH0045 Uncharacterized HTH-type transcriptional regulator PH0045 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
O31497 2.67e-12 63 32 1 107 4 yezC Uncharacterized HTH-type transcriptional regulator YezC Bacillus subtilis (strain 168)
O59256 2.76e-12 63 29 1 143 3 lrpA HTH-type transcriptional regulator LrpA Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9V159 9.47e-12 62 29 1 143 3 lrpA HTH-type transcriptional regulator LrpA Pyrococcus abyssi (strain GE5 / Orsay)
Q9V2M0 1.14e-11 62 28 2 121 4 PYRAB00550 Uncharacterized HTH-type transcriptional regulator PYRAB00550 Pyrococcus abyssi (strain GE5 / Orsay)
Q58133 1.8e-11 61 24 1 143 1 ptr2 HTH-type transcriptional regulator Ptr2 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
P44337 6.48e-11 60 24 2 141 3 asnC Regulatory protein AsnC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9V1E5 8.73e-11 60 27 3 151 4 PYRAB04820 Uncharacterized HTH-type transcriptional regulator PYRAB04820 Pyrococcus abyssi (strain GE5 / Orsay)
P0ACI9 2.19e-10 58 25 2 140 3 asnC Regulatory protein AsnC Shigella flexneri
P0ACI6 2.19e-10 58 25 2 140 1 asnC Regulatory protein AsnC Escherichia coli (strain K12)
P0ACI7 2.19e-10 58 25 2 140 3 asnC Regulatory protein AsnC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ACI8 2.19e-10 58 25 2 140 3 asnC Regulatory protein AsnC Escherichia coli O157:H7
Q8U067 5.42e-10 57 26 3 152 4 PF1734 Uncharacterized HTH-type transcriptional regulator PF1734 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
O59309 1.3e-09 57 27 3 152 4 PH1692 Uncharacterized HTH-type transcriptional regulator PH1692 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q8U1H7 2.78e-09 55 23 1 138 4 PF1231 Uncharacterized HTH-type transcriptional regulator PF1231 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
P96653 3.16e-08 53 28 2 144 4 lrpB HTH-type transcriptional regulator LrpB Bacillus subtilis (strain 168)
O05217 1.2e-07 52 34 2 95 4 ywrC Uncharacterized HTH-type transcriptional regulator YwrC Bacillus subtilis (strain 168)
O05236 1.41e-05 46 21 2 145 4 yugG Uncharacterized HTH-type transcriptional regulator YugG Bacillus subtilis (strain 168)
O58782 2.06e-05 45 27 3 133 4 PH1055 Uncharacterized HTH-type transcriptional regulator PH1055 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
B0R717 3.16e-05 45 21 2 147 4 lrp HTH-type transcriptional regulator Lrp Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q8U2H1 0.00046 42 35 2 82 1 PF0864 Uncharacterized HTH-type transcriptional regulator PF0864 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS03425
Feature type CDS
Gene lrp
Product leucine-responsive transcriptional regulator Lrp
Location 757996 - 758490 (strand: 1)
Length 495 (nucleotides) / 164 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1219
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01037 Lrp/AsnC ligand binding domain
PF13412 Winged helix-turn-helix DNA-binding

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1522 Transcription (K) K DNA-binding transcriptional regulator, Lrp family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03719 Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein - -

Protein Sequence

MIDNKKRPGKDLDRIDRNILNELQKDGRISNVELSKRVGLSPTPCLERVRRLERQGFISGYTALLNPHYLDASLLVFVEITLNRGAPDVFEQFNMAVQKLEEIQECHLVSGDFDYLLKTRVPDMSAYRKLLGETLLRLPGVNDTRTYVVMEEVKQSNRLVIKTR

Flanking regions ( +/- flanking 50bp)

TATGGGTATAGGAAAATAAAGTAAGAGAAAAAGAGAAAGAGAGTATAGAGATGATTGATAATAAAAAACGTCCGGGTAAAGATCTTGATAGAATAGACCGGAATATTCTAAATGAGCTTCAGAAAGATGGTCGTATCTCAAACGTTGAGCTGTCTAAACGCGTTGGTTTATCACCAACCCCATGTTTAGAGCGTGTACGCCGATTAGAACGCCAAGGATTTATTTCTGGTTATACTGCGCTATTAAACCCCCATTACCTAGATGCATCTCTGTTGGTATTTGTGGAAATCACATTAAACCGTGGTGCACCAGATGTCTTTGAACAATTTAATATGGCTGTTCAAAAACTTGAAGAGATCCAAGAATGTCATTTAGTTTCTGGTGACTTTGACTATCTGTTGAAAACTCGTGTACCTGATATGTCTGCTTATCGTAAATTATTAGGCGAAACGCTATTACGTCTTCCTGGTGTAAACGACACCCGCACTTATGTGGTGATGGAAGAAGTAAAACAAAGCAATCGCCTAGTGATTAAAACACGCTAAGCCTGCTAATAGGTTAGTGCAAAACAGGATAAAGTTAGGTACACTCCTGT