Homologs in group_1203

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_06985 FBDBKF_06985 79.3 Morganella morganii S1 grxA GrxA family glutaredoxin
EHELCC_03985 EHELCC_03985 79.3 Morganella morganii S2 grxA GrxA family glutaredoxin
NLDBIP_03985 NLDBIP_03985 79.3 Morganella morganii S4 grxA GrxA family glutaredoxin
LHKJJB_09815 LHKJJB_09815 79.3 Morganella morganii S3 grxA GrxA family glutaredoxin
HKOGLL_09160 HKOGLL_09160 79.3 Morganella morganii S5 grxA GrxA family glutaredoxin
F4V73_RS01175 F4V73_RS01175 78.2 Morganella psychrotolerans - GrxA family glutaredoxin

Distribution of the homologs in the orthogroup group_1203

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1203

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9KSW0 2.87e-51 158 83 0 87 3 grx Glutaredoxin Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P0A1P8 4.32e-50 155 80 0 86 3 grxA Glutaredoxin 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1P9 4.32e-50 155 80 0 86 3 grxA Glutaredoxin 1 Salmonella typhi
P45242 1.05e-44 141 81 0 85 3 grxA Glutaredoxin Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P68689 1.1e-39 129 71 0 83 3 grxA Glutaredoxin 1 Shigella flexneri
P68688 1.1e-39 129 71 0 83 1 grxA Glutaredoxin 1 Escherichia coli (strain K12)
Q9HU55 1.56e-12 60 39 2 78 3 grx Glutaredoxin Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q9ZDW1 2.25e-10 55 35 2 81 3 grxC1 Glutaredoxin 1 Rickettsia prowazekii (strain Madrid E)
P0AC62 1.46e-09 52 42 3 75 1 grxC Glutaredoxin 3 Escherichia coli (strain K12)
P0AC63 1.46e-09 52 42 3 75 3 grxC Glutaredoxin 3 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AC64 1.46e-09 52 42 3 75 3 grxC Glutaredoxin 3 Escherichia coli O157:H7
Q1RHJ0 3.76e-09 52 35 3 81 3 grxC1 Glutaredoxin 1 Rickettsia bellii (strain RML369-C)
Q68XG4 4.48e-09 52 36 3 77 3 grxC1 Glutaredoxin 1 Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q92J02 6.39e-09 51 34 2 72 3 grxC1 Glutaredoxin 1 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q9FNE2 8.24e-09 51 39 3 71 3 GRXC2 Glutaredoxin-C2 Arabidopsis thaliana
P10575 1.23e-08 50 40 4 76 1 GLRX Glutaredoxin-1 Bos taurus
P55142 1.54e-08 50 37 3 80 1 GRXC6 Glutaredoxin-C6 Oryza sativa subsp. japonica
Q4UKL7 1.62e-08 50 36 2 72 3 grxC1 Glutaredoxin 1 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q9ESH6 1.65e-08 50 36 3 82 3 Glrx Glutaredoxin-1 Rattus norvegicus
Q0DAE4 2.03e-08 51 42 4 78 2 GRXC8 Glutaredoxin-C8 Oryza sativa subsp. japonica
P12309 2.14e-08 50 38 3 81 1 GLRX Glutaredoxin-1 Sus scrofa
P35754 4.89e-08 49 36 3 82 1 GLRX Glutaredoxin-1 Homo sapiens
P44758 6.14e-08 51 39 2 76 1 PGdx Hybrid peroxiredoxin hyPrx5 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q6K953 6.29e-08 49 36 3 79 3 GRXC4 Glutaredoxin-C4, chloroplastic Oryza sativa subsp. japonica
Q9FVX1 9.24e-08 49 38 4 83 2 GRXC3 Glutaredoxin-C3 Arabidopsis thaliana
Q9QUH0 1.11e-07 48 38 3 76 1 Glrx Glutaredoxin-1 Mus musculus
Q54GP8 2.97e-07 47 37 5 82 2 grxA Glutaredoxin Dictyostelium discoideum
P55143 3.34e-07 47 35 3 76 3 None Glutaredoxin Ricinus communis
O36032 3.45e-07 47 33 3 80 3 grx1 Glutaredoxin-1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9ZR41 8.67e-07 46 36 3 80 3 None Glutaredoxin Solanum lycopersicum
Q9JVU9 3.79e-06 43 36 4 79 3 grx Glutaredoxin Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9JY15 3.96e-06 43 36 4 79 3 grx Glutaredoxin Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q8L8T2 6.29e-06 44 38 3 71 2 GRXC1 Glutaredoxin-C1 Arabidopsis thaliana
P12864 1.1e-05 43 32 3 84 1 GLRX Glutaredoxin-1 Oryctolagus cuniculus
B7ZFT1 1.34e-05 43 37 2 75 2 GRX1 Glutaredoxin-1 Rhizophagus irregularis (strain DAOM 181602 / DAOM 197198 / MUCL 43194)
Q8LFQ6 1.65e-05 43 35 5 87 2 GRXC4 Glutaredoxin-C4 Arabidopsis thaliana
O81187 2.27e-05 42 35 3 64 3 None Glutaredoxin Vernicia fordii
Q86VQ6 2.31e-05 44 35 3 77 1 TXNRD3 Thioredoxin reductase 3 Homo sapiens
Q8GWS0 4.56e-05 42 34 2 72 1 GRXC5 Glutaredoxin-C5, chloroplastic Arabidopsis thaliana
Q6H628 6.51e-05 41 32 3 73 2 GRXS6 Monothiol glutaredoxin-S6 Oryza sativa subsp. japonica
Q0J3L4 9.42e-05 41 33 2 72 2 GRXS10 Monothiol glutaredoxin-S10 Oryza sativa subsp. japonica
P73492 0.000107 40 32 2 75 1 ssr2061 Probable glutaredoxin ssr2061 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q32L67 0.000217 40 35 3 80 2 GLRX2 Glutaredoxin-2, mitochondrial Bos taurus
Q9NS18 0.000266 40 35 3 80 1 GLRX2 Glutaredoxin-2, mitochondrial Homo sapiens
Q99MD6 0.000519 40 29 3 77 1 Txnrd3 Thioredoxin reductase 3 Mus musculus
Q9Y7N3 0.000552 39 33 2 80 3 grx3 Monothiol glutaredoxin-3 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q5RC53 0.000559 39 35 3 80 2 GLRX2 Glutaredoxin-2, mitochondrial Pongo abelii
Q923X4 0.001 38 29 3 84 1 Glrx2 Glutaredoxin-2, mitochondrial Mus musculus

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS03320
Feature type CDS
Gene -
Product GrxA family glutaredoxin
Location 734844 - 735107 (strand: -1)
Length 264 (nucleotides) / 87 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1203
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00462 Glutaredoxin

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0695 Posttranslational modification, protein turnover, chaperones (O) O Glutaredoxin

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03674 glutaredoxin 1 - -

Protein Sequence

MFVVIFGRPGCPYCVRAKQLAETLSEKRDDFDFRYVDIQAEGITKADLSKTVGKPVETVPQIFIDEKHIGGCTDFEAYAKEHLGIYN

Flanking regions ( +/- flanking 50bp)

CAAATAAAGACTATTATGCCTGAATTTATTTCCTCAATAAGGAGTGTCGTATGTTTGTTGTAATTTTTGGTCGTCCTGGTTGCCCATATTGTGTCCGAGCTAAACAACTTGCTGAAACCTTGTCTGAAAAACGTGATGACTTTGATTTCCGCTATGTGGATATTCAAGCTGAAGGTATTACCAAAGCAGACTTATCAAAAACTGTCGGTAAACCAGTTGAAACTGTGCCACAAATTTTTATTGATGAAAAACACATTGGTGGCTGCACAGATTTTGAAGCTTATGCGAAAGAGCATTTAGGCATCTATAACTAATTTTTAAAACGCTAAAATACTTTATTTATCAATGTGTTTTAGCGTTTTCA