Homologs in group_1261

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_03985 EHELCC_03985 100.0 Morganella morganii S2 grxA GrxA family glutaredoxin
NLDBIP_03985 NLDBIP_03985 100.0 Morganella morganii S4 grxA GrxA family glutaredoxin
LHKJJB_09815 LHKJJB_09815 100.0 Morganella morganii S3 grxA GrxA family glutaredoxin
HKOGLL_09160 HKOGLL_09160 100.0 Morganella morganii S5 grxA GrxA family glutaredoxin
F4V73_RS01175 F4V73_RS01175 90.8 Morganella psychrotolerans - GrxA family glutaredoxin
PMI_RS03320 PMI_RS03320 79.3 Proteus mirabilis HI4320 - GrxA family glutaredoxin

Distribution of the homologs in the orthogroup group_1261

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1261

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A1P8 5.59e-52 160 83 0 87 3 grxA Glutaredoxin 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A1P9 5.59e-52 160 83 0 87 3 grxA Glutaredoxin 1 Salmonella typhi
Q9KSW0 1.07e-49 154 82 0 86 3 grx Glutaredoxin Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P45242 6.62e-46 144 78 0 87 3 grxA Glutaredoxin Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P68689 5.45e-43 137 74 0 83 3 grxA Glutaredoxin 1 Shigella flexneri
P68688 5.45e-43 137 74 0 83 1 grxA Glutaredoxin 1 Escherichia coli (strain K12)
Q9HU55 3.3e-10 54 36 2 79 3 grx Glutaredoxin Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q68XG4 2.71e-08 50 37 3 74 3 grxC1 Glutaredoxin 1 Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q9ZDW1 2.72e-08 49 37 3 74 3 grxC1 Glutaredoxin 1 Rickettsia prowazekii (strain Madrid E)
P10575 4.07e-08 49 36 2 73 1 GLRX Glutaredoxin-1 Bos taurus
Q0DAE4 4.23e-08 50 38 4 84 2 GRXC8 Glutaredoxin-C8 Oryza sativa subsp. japonica
P0AC62 4.36e-08 48 36 2 73 1 grxC Glutaredoxin 3 Escherichia coli (strain K12)
P0AC63 4.36e-08 48 36 2 73 3 grxC Glutaredoxin 3 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AC64 4.36e-08 48 36 2 73 3 grxC Glutaredoxin 3 Escherichia coli O157:H7
Q54GP8 5.02e-08 49 39 3 71 2 grxA Glutaredoxin Dictyostelium discoideum
P44758 5.33e-08 51 36 2 83 1 PGdx Hybrid peroxiredoxin hyPrx5 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9FNE2 9.87e-08 48 38 3 70 3 GRXC2 Glutaredoxin-C2 Arabidopsis thaliana
P12309 1.32e-07 48 35 3 80 1 GLRX Glutaredoxin-1 Sus scrofa
P55142 2.23e-07 47 36 3 74 1 GRXC6 Glutaredoxin-C6 Oryza sativa subsp. japonica
Q92J02 2.34e-07 47 33 2 71 3 grxC1 Glutaredoxin 1 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P35754 2.35e-07 47 33 3 81 1 GLRX Glutaredoxin-1 Homo sapiens
Q1RHJ0 3.58e-07 47 35 2 76 3 grxC1 Glutaredoxin 1 Rickettsia bellii (strain RML369-C)
Q9FVX1 4.46e-07 47 40 4 76 2 GRXC3 Glutaredoxin-C3 Arabidopsis thaliana
Q4UKL7 5.53e-07 46 35 2 71 3 grxC1 Glutaredoxin 1 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q9ESH6 2.46e-06 45 33 3 75 3 Glrx Glutaredoxin-1 Rattus norvegicus
P55143 5.1e-06 44 33 3 77 3 None Glutaredoxin Ricinus communis
Q6K953 5.63e-06 44 34 3 78 3 GRXC4 Glutaredoxin-C4, chloroplastic Oryza sativa subsp. japonica
Q8LFQ6 6.58e-06 44 38 5 84 2 GRXC4 Glutaredoxin-C4 Arabidopsis thaliana
Q9QUH0 1.25e-05 43 32 3 75 1 Glrx Glutaredoxin-1 Mus musculus
Q86VQ6 1.92e-05 44 35 3 81 1 TXNRD3 Thioredoxin reductase 3 Homo sapiens
P12864 2.43e-05 42 30 2 76 1 GLRX Glutaredoxin-1 Oryctolagus cuniculus
Q9ZR41 2.8e-05 42 33 3 71 3 None Glutaredoxin Solanum lycopersicum
B7ZFT1 7.65e-05 41 35 3 82 2 GRX1 Glutaredoxin-1 Rhizophagus irregularis (strain DAOM 181602 / DAOM 197198 / MUCL 43194)
O36032 7.74e-05 41 33 3 78 3 grx1 Glutaredoxin-1 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
O81187 0.000132 40 36 3 63 3 None Glutaredoxin Vernicia fordii
Q6H628 0.000271 40 35 5 81 2 GRXS6 Monothiol glutaredoxin-S6 Oryza sativa subsp. japonica
P73492 0.000392 38 36 3 77 1 ssr2061 Probable glutaredoxin ssr2061 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q99MD6 0.000499 40 29 3 81 1 Txnrd3 Thioredoxin reductase 3 Mus musculus
Q9JY15 0.000574 38 35 3 76 3 grx Glutaredoxin Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JVU9 0.000587 38 35 3 76 3 grx Glutaredoxin Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_06985
Feature type CDS
Gene grxA
Product GrxA family glutaredoxin
Location 62597 - 62860 (strand: -1)
Length 264 (nucleotides) / 87 (amino acids)
In genomic island -

Contig

Accession contig_7
Length 171383 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1261
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00462 Glutaredoxin

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0695 Posttranslational modification, protein turnover, chaperones (O) O Glutaredoxin

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03674 glutaredoxin 1 - -

Protein Sequence

MYTVIFGRPGCPYCVRAKELAEKLKNERDDFDYRYIDIHAEGISKEDLSVTVGKPVETVPQIFIDEKHIGGCTDFEAYAKANLGLFS

Flanking regions ( +/- flanking 50bp)

TCCCATTAAAGCACCACTTCCGGTGTTACTGATGAATGAAGGAGCTTTTCATGTATACCGTTATTTTTGGCCGTCCGGGTTGTCCTTATTGTGTTCGTGCGAAAGAACTCGCAGAAAAACTGAAAAATGAGCGTGATGACTTCGATTATCGCTATATTGATATTCACGCTGAAGGCATCAGCAAAGAAGATTTATCTGTCACTGTCGGCAAACCGGTTGAAACGGTTCCTCAGATTTTTATCGATGAAAAGCACATCGGCGGCTGCACTGATTTCGAAGCTTACGCGAAAGCCAATCTTGGTCTGTTCAGCTAAGCTATCCGGCCGTTTCCCGCCCGGGAAGCGGCTTATTTATTCCTCCCTAT