Homologs in group_1484

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09575 FBDBKF_09575 71.6 Morganella morganii S1 moaD molybdopterin synthase sulfur carrier subunit
EHELCC_04375 EHELCC_04375 71.6 Morganella morganii S2 moaD molybdopterin synthase sulfur carrier subunit
NLDBIP_04375 NLDBIP_04375 71.6 Morganella morganii S4 moaD molybdopterin synthase sulfur carrier subunit
LHKJJB_14255 LHKJJB_14255 71.6 Morganella morganii S3 moaD molybdopterin synthase sulfur carrier subunit
HKOGLL_12280 HKOGLL_12280 71.6 Morganella morganii S5 moaD molybdopterin synthase sulfur carrier subunit
F4V73_RS00770 F4V73_RS00770 67.9 Morganella psychrotolerans moaD molybdopterin synthase sulfur carrier subunit

Distribution of the homologs in the orthogroup group_1484

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1484

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P30748 2.97e-35 117 67 0 81 1 moaD Molybdopterin synthase sulfur carrier subunit Escherichia coli (strain K12)
P45309 7.09e-32 108 59 0 81 3 moaD Molybdopterin synthase sulfur carrier subunit Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O31706 3.21e-11 56 34 2 81 3 moaD Molybdopterin synthase sulfur carrier subunit Bacillus subtilis (strain 168)
A8JJB2 8.09e-08 48 39 3 83 3 CHLREDRAFT_109356 Molybdopterin synthase sulfur carrier subunit Chlamydomonas reinhardtii
B6SXF8 5.14e-07 46 34 3 84 2 VP15 Molybdopterin synthase sulfur carrier subunit Zea mays
Q54NM8 6.48e-07 45 38 3 83 3 mocs2s Molybdopterin synthase sulfur carrier subunit Dictyostelium discoideum
Q5TT27 6.58e-06 43 31 3 86 3 Mocs2 Molybdopterin synthase sulfur carrier subunit Anopheles gambiae
Q9S7A3 9.81e-06 43 32 4 85 3 At4g10100 Molybdopterin synthase sulfur carrier subunit Arabidopsis thaliana
B3P6R4 4.2e-05 41 34 4 86 3 Mocs2A Molybdopterin synthase sulfur carrier subunit Drosophila erecta
D4GVB0 0.000113 40 37 4 90 1 samp3 Small archaeal modifier protein 3 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
B4PUD0 0.00012 40 33 4 86 3 Mocs2A Molybdopterin synthase sulfur carrier subunit Drosophila yakuba
Q6YVX4 0.00035 39 25 2 92 3 Os02g0558300 Molybdopterin synthase sulfur carrier subunit Oryza sativa subsp. japonica
A2X635 0.00035 39 25 2 92 3 OsI_07667 Molybdopterin synthase sulfur carrier subunit Oryza sativa subsp. indica
B3M269 0.000501 38 32 4 86 3 Mocs2A Molybdopterin synthase sulfur carrier subunit Drosophila ananassae
P0C919 0.000737 38 31 4 85 3 Mocs2A Molybdopterin synthase sulfur carrier subunit Drosophila melanogaster
Q7A441 0.001 37 31 4 82 1 moaD Molybdopterin synthase sulfur carrier subunit Staphylococcus aureus (strain N315)
B4QUC1 0.001 37 31 2 83 3 Mocs2A Molybdopterin synthase sulfur carrier subunit Drosophila simulans

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS03015
Feature type CDS
Gene moaD
Product molybdopterin synthase sulfur carrier subunit
Location 665306 - 665551 (strand: 1)
Length 246 (nucleotides) / 81 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1484
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02597 ThiS family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1977 Coenzyme transport and metabolism (H) H Molybdopterin synthase sulfur carrier subunit MoaD

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03636 sulfur-carrier protein Sulfur relay system -

Protein Sequence

MIKVLFFAQVRELVGVDSLELQNDYPTVDDLRRALINKGDRWALALEDGKLLSAVNQSFVQGTYAIKDGDEVAFFPPVTGG

Flanking regions ( +/- flanking 50bp)

CGTTTATTAGAAAAAACCGGTGGTAAATCGGGACACTTTAAGGTGGATGCATGATTAAGGTTCTTTTTTTCGCCCAAGTGCGTGAATTAGTGGGTGTTGATTCACTGGAATTACAAAATGATTATCCAACAGTGGATGATTTACGCCGTGCTTTAATTAACAAAGGCGATCGTTGGGCATTAGCGCTTGAAGATGGCAAATTGTTATCCGCAGTAAATCAATCCTTTGTTCAAGGCACTTATGCCATTAAAGACGGTGATGAAGTGGCTTTTTTCCCACCTGTAACAGGGGGCTAAGATGAGTACATTGACCCGTATATCAGTCCAAAACGAACATTTTAATGTTG