Homologs in group_1532

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09575 FBDBKF_09575 88.9 Morganella morganii S1 moaD molybdopterin synthase sulfur carrier subunit
EHELCC_04375 EHELCC_04375 88.9 Morganella morganii S2 moaD molybdopterin synthase sulfur carrier subunit
NLDBIP_04375 NLDBIP_04375 88.9 Morganella morganii S4 moaD molybdopterin synthase sulfur carrier subunit
LHKJJB_14255 LHKJJB_14255 88.9 Morganella morganii S3 moaD molybdopterin synthase sulfur carrier subunit
HKOGLL_12280 HKOGLL_12280 88.9 Morganella morganii S5 moaD molybdopterin synthase sulfur carrier subunit
PMI_RS03015 PMI_RS03015 67.9 Proteus mirabilis HI4320 moaD molybdopterin synthase sulfur carrier subunit

Distribution of the homologs in the orthogroup group_1532

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1532

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P30748 5.8e-34 114 65 0 81 1 moaD Molybdopterin synthase sulfur carrier subunit Escherichia coli (strain K12)
P45309 2.1e-32 110 59 0 81 3 moaD Molybdopterin synthase sulfur carrier subunit Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O31706 1.61e-09 52 35 2 82 3 moaD Molybdopterin synthase sulfur carrier subunit Bacillus subtilis (strain 168)
Q7A441 6.48e-07 45 32 2 81 1 moaD Molybdopterin synthase sulfur carrier subunit Staphylococcus aureus (strain N315)
L7N6B4 9.49e-06 42 34 2 81 3 moaD1 Molybdopterin synthase sulfur carrier subunit Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
B4PUD0 3.61e-05 41 37 5 85 3 Mocs2A Molybdopterin synthase sulfur carrier subunit Drosophila yakuba
B3P6R4 4.88e-05 41 36 4 84 3 Mocs2A Molybdopterin synthase sulfur carrier subunit Drosophila erecta
Q54NM8 5.42e-05 40 31 3 82 3 mocs2s Molybdopterin synthase sulfur carrier subunit Dictyostelium discoideum
A8JJB2 8.39e-05 40 36 4 85 3 CHLREDRAFT_109356 Molybdopterin synthase sulfur carrier subunit Chlamydomonas reinhardtii
P0C919 0.00022 39 34 4 85 3 Mocs2A Molybdopterin synthase sulfur carrier subunit Drosophila melanogaster
B4QUC1 0.000253 39 34 4 85 3 Mocs2A Molybdopterin synthase sulfur carrier subunit Drosophila simulans
B3M269 0.000323 38 36 4 84 3 Mocs2A Molybdopterin synthase sulfur carrier subunit Drosophila ananassae
Q1DGL5 0.000433 38 32 5 88 3 Mocs2-1 Molybdopterin synthase sulfur carrier subunit Aedes aegypti
B4IJG8 0.000486 38 34 4 85 3 Mocs2A Molybdopterin synthase sulfur carrier subunit Drosophila sechellia

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS00770
Feature type CDS
Gene moaD
Product molybdopterin synthase sulfur carrier subunit
Location 160872 - 161117 (strand: 1)
Length 246 (nucleotides) / 81 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1532
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02597 ThiS family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1977 Coenzyme transport and metabolism (H) H Molybdopterin synthase sulfur carrier subunit MoaD

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03636 sulfur-carrier protein Sulfur relay system -

Protein Sequence

MITVLFFAQVRELINTDELSLACEYATAEDLRSTLSERGDRWALALESGKLLCAVNQSFVPLSHPLQDGDEVAFFPPVTGG

Flanking regions ( +/- flanking 50bp)

TGGTTACTGGAAAAGAGCGGCGGAAAATCAGGTCACTTTAAGGCGGATGCATGATTACAGTGCTGTTTTTCGCGCAGGTGCGCGAGCTTATCAATACAGATGAACTGTCTCTGGCATGTGAGTACGCCACCGCTGAGGATTTGCGCAGCACTTTGAGTGAGCGCGGCGATCGCTGGGCACTCGCACTGGAGTCCGGTAAATTATTATGTGCGGTAAATCAGTCATTTGTGCCGCTGTCTCATCCGTTACAGGATGGTGATGAAGTGGCGTTTTTCCCGCCGGTTACCGGAGGCTGAGTGATGAACAATACCCGGATTGCCGTTCAGACAGACAATTTCAGTGTCGG