Homologs in group_1489

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09610 FBDBKF_09610 41.1 Morganella morganii S1 bioC malonyl-ACP O-methyltransferase BioC
EHELCC_04410 EHELCC_04410 41.1 Morganella morganii S2 bioC malonyl-ACP O-methyltransferase BioC
NLDBIP_04410 NLDBIP_04410 41.1 Morganella morganii S4 bioC malonyl-ACP O-methyltransferase BioC
LHKJJB_14220 LHKJJB_14220 41.1 Morganella morganii S3 bioC malonyl-ACP O-methyltransferase BioC
HKOGLL_12315 HKOGLL_12315 41.1 Morganella morganii S5 bioC malonyl-ACP O-methyltransferase BioC
F4V73_RS00730 F4V73_RS00730 41.5 Morganella psychrotolerans bioC malonyl-ACP O-methyltransferase BioC

Distribution of the homologs in the orthogroup group_1489

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1489

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P36571 1.2e-65 207 44 2 253 1 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Serratia marcescens
Q6D3C1 1.86e-65 207 43 1 245 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7CH67 1.49e-62 200 44 1 251 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Yersinia pestis
D8MPW4 2.06e-60 194 42 1 244 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Erwinia billingiae (strain Eb661)
D2T333 2.02e-59 192 43 1 246 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Erwinia pyrifoliae (strain DSM 12163 / CIP 106111 / Ep16/96)
C4K5L7 3.13e-58 188 41 1 246 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
E3G327 3.8e-55 180 41 1 248 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Enterobacter lignolyticus (strain SCF1)
P12999 6.97e-55 180 40 1 247 1 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Escherichia coli (strain K12)
Q8ZQQ6 8.74e-55 179 42 1 247 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q89AK7 3.69e-54 177 37 2 245 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
O06898 1.02e-47 161 40 1 230 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Pseudescherichia vulneris
B3PI89 4.7e-39 144 36 5 250 3 bioC Biotin biosynthesis bifunctional protein BioHC Cellvibrio japonicus (strain Ueda107)
Q2SBD7 1.86e-38 138 34 4 236 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Hahella chejuensis (strain KCTC 2396)
A6UYW3 5.1e-38 137 35 4 253 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Pseudomonas aeruginosa (strain PA7)
C1D5S5 2.82e-34 128 32 8 272 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Laribacter hongkongensis (strain HLHK9)
Q609U9 1.44e-33 125 31 6 242 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A1WVM4 1.83e-33 125 33 9 260 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Halorhodospira halophila (strain DSM 244 / SL1)
Q5ZT34 2.59e-33 125 30 6 264 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q21FY5 6.86e-32 125 32 6 259 3 bioC Biotin biosynthesis bifunctional protein BioHC Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
D9SJ16 2.19e-31 120 33 8 262 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Gallionella capsiferriformans (strain ES-2)
Q47C02 2.47e-31 119 33 8 263 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Dechloromonas aromatica (strain RCB)
E4QJB8 3.17e-29 114 32 9 265 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Methylovorus sp. (strain MP688)
A4G5P1 1.84e-28 112 32 8 252 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Herminiimonas arsenicoxydans
C5BMZ8 2.52e-28 115 32 7 255 3 bioC Biotin biosynthesis bifunctional protein BioHC Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q83E64 1.59e-26 107 28 6 257 3 bioC1 Malonyl-[acyl-carrier protein] O-methyltransferase 1 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q2Y9Y6 1.65e-26 107 28 7 277 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
E3HCT1 7.21e-26 105 28 10 240 3 bioC2 Malonyl-[acyl-carrier protein] O-methyltransferase 2 Ilyobacter polytropus (strain ATCC 51220 / DSM 2926 / LMG 16218 / CuHBu1)
E3H9W1 6.48e-25 102 28 9 242 3 bioC1 Malonyl-[acyl-carrier protein] O-methyltransferase 1 Ilyobacter polytropus (strain ATCC 51220 / DSM 2926 / LMG 16218 / CuHBu1)
A6W0X8 6.11e-24 100 30 5 217 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Marinomonas sp. (strain MWYL1)
Q9K623 1.18e-22 96 29 9 255 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B2IAI0 6.28e-21 92 32 7 235 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Xylella fastidiosa (strain M23)
Q8EDK8 1.15e-19 89 31 4 205 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0VMD3 6.01e-19 87 30 6 218 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A3DBD7 9.71e-19 86 26 11 252 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q83CU8 8.1e-18 83 30 10 230 3 bioC2 Malonyl-[acyl-carrier protein] O-methyltransferase 2 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
C6CWS7 1.03e-16 80 28 11 272 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Paenibacillus sp. (strain JDR-2)
A7GSD9 2.55e-16 79 26 7 219 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
D5DIV9 3.1e-15 76 24 7 227 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Priestia megaterium (strain DSM 319 / IMG 1521)
E4TI44 9.25e-15 74 29 4 160 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Calditerrivibrio nitroreducens (strain DSM 19672 / NBRC 101217 / Yu37-1)
Q81MB2 1.06e-14 75 26 9 221 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Bacillus anthracis
Q818X2 5.03e-14 73 25 8 221 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q2KXN6 1.82e-13 72 29 9 253 3 bioCD Biotin biosynthesis bifunctional protein BioCD Bordetella avium (strain 197N)
Q5TEU4 1.23e-12 70 24 7 213 1 NDUFAF5 Arginine-hydroxylase NDUFAF5, mitochondrial Homo sapiens
A0L3L9 1.34e-12 69 29 11 221 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
B2GV71 1.41e-12 69 24 7 212 2 Ndufaf5 Arginine-hydroxylase NDUFAF5, mitochondrial Rattus norvegicus
Q5RBS1 1.52e-12 69 24 7 213 2 NDUFAF5 Arginine-hydroxylase NDUFAF5, mitochondrial Pongo abelii
Q3B172 2.96e-12 68 29 6 159 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
A2APY7 4.52e-12 68 24 7 212 1 Ndufaf5 Arginine-hydroxylase NDUFAF5, mitochondrial Mus musculus
A4SGV9 4.59e-12 67 24 9 233 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q6FFY1 1.1e-11 66 30 5 155 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
B7GHW9 1.64e-11 65 25 8 218 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
C3LLV3 1.06e-10 63 28 6 166 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio cholerae serotype O1 (strain M66-2)
Q9KSJ9 1.06e-10 63 28 6 166 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F1U0 1.06e-10 63 28 6 166 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
C0Z787 4.05e-10 62 26 14 269 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
A4WCN5 1.03e-09 60 28 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Enterobacter sp. (strain 638)
B1JS96 1.85e-09 60 28 4 153 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66CZ4 1.85e-09 60 28 4 153 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TNI8 1.85e-09 60 28 4 153 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pestis (strain Pestoides F)
Q1CFZ1 1.85e-09 60 28 4 153 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pestis bv. Antiqua (strain Nepal516)
A9R284 1.85e-09 60 28 4 153 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZGR6 1.85e-09 60 28 4 153 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pestis
B2K9A4 1.85e-09 60 28 4 153 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C9H5 1.85e-09 60 28 4 153 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FKF4 1.85e-09 60 28 4 153 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JLA0 3.57e-09 58 27 4 153 3 ubiG Ubiquinone biosynthesis O-methyltransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A7MU79 4e-09 58 32 2 104 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio campbellii (strain ATCC BAA-1116)
A8ADY5 4.32e-09 58 28 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A6TBT7 5.72e-09 58 28 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q5E5J8 5.94e-09 58 28 6 166 3 ubiG Ubiquinone biosynthesis O-methyltransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q7N2M5 6.06e-09 58 28 4 150 3 ubiG Ubiquinone biosynthesis O-methyltransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q9JXI7 7.86e-09 58 32 4 120 3 ubiG Ubiquinone biosynthesis O-methyltransferase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q87TH4 8.09e-09 58 27 5 166 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q87ND5 8.17e-09 57 32 2 104 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B5FDT8 9.25e-09 57 28 6 166 3 ubiG Ubiquinone biosynthesis O-methyltransferase Aliivibrio fischeri (strain MJ11)
Q9JWE6 1.03e-08 57 32 4 120 3 ubiG Ubiquinone biosynthesis O-methyltransferase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
C1DRQ3 1.09e-08 57 34 2 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q5QYG2 1.12e-08 57 26 5 168 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A9MJY3 1.19e-08 57 28 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A9M0C4 1.26e-08 57 33 3 108 3 ubiG Ubiquinone biosynthesis O-methyltransferase Neisseria meningitidis serogroup C (strain 053442)
B0V5X4 1.62e-08 57 29 5 155 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baumannii (strain AYE)
B7IBN2 1.62e-08 57 29 5 155 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baumannii (strain AB0057)
B7H2Y9 1.62e-08 57 29 5 155 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baumannii (strain AB307-0294)
Q7MM27 1.62e-08 57 32 2 104 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio vulnificus (strain YJ016)
Q8D8E0 1.62e-08 57 32 2 104 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio vulnificus (strain CMCP6)
B0VMN8 1.66e-08 57 29 5 155 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baumannii (strain SDF)
B5XNZ3 1.88e-08 57 27 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Klebsiella pneumoniae (strain 342)
Q8FFP0 2.03e-08 57 28 5 150 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8GGX8 2.09e-08 57 27 4 154 3 ubiG Ubiquinone biosynthesis O-methyltransferase Serratia proteamaculans (strain 568)
B2I023 2.42e-08 56 28 5 155 3 ubiG Ubiquinone biosynthesis O-methyltransferase Acinetobacter baumannii (strain ACICU)
Q749W5 2.71e-08 56 21 7 261 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B7VGS0 2.99e-08 56 31 2 104 3 ubiG Ubiquinone biosynthesis O-methyltransferase Vibrio atlanticus (strain LGP32)
Q8A7S9 5.06e-08 55 27 5 156 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
C6DBN5 5.1e-08 55 28 4 150 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B4EZ30 5.85e-08 55 27 5 165 3 ubiG Ubiquinone biosynthesis O-methyltransferase Proteus mirabilis (strain HI4320)
Q64VX6 6.36e-08 56 26 5 161 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Bacteroides fragilis (strain YCH46)
B7NN47 9.04e-08 55 26 4 155 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q54JW0 9.41e-08 55 28 3 127 1 ndufaf5 Arginine-hydroxylase NDUFAF5, mitochondrial Dictyostelium discoideum
E1WTS2 9.53e-08 55 26 5 160 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Bacteroides fragilis (strain 638R)
B1LLI3 1e-07 54 26 4 155 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain SMS-3-5 / SECEC)
B7LM95 1.01e-07 54 27 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q2Y6Z3 1.07e-07 54 31 3 116 3 ubiG Ubiquinone biosynthesis O-methyltransferase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B5YX17 1.14e-07 54 27 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XE29 1.14e-07 54 27 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O157:H7
Q7VKW2 1.17e-07 54 26 4 153 3 ubiG Ubiquinone biosynthesis O-methyltransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B0UUV6 1.21e-07 54 26 4 152 3 ubiG Ubiquinone biosynthesis O-methyltransferase Histophilus somni (strain 2336)
Q6LPD7 1.21e-07 54 23 6 216 3 ubiG Ubiquinone biosynthesis O-methyltransferase Photobacterium profundum (strain SS9)
A1K8Q1 1.21e-07 54 33 1 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Azoarcus sp. (strain BH72)
B5BCS0 1.22e-07 54 26 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella paratyphi A (strain AKU_12601)
Q5PCY1 1.22e-07 54 26 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q0I3Y4 1.25e-07 54 26 4 152 3 ubiG Ubiquinone biosynthesis O-methyltransferase Histophilus somni (strain 129Pt)
B1IXV6 1.26e-07 54 27 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q32DV8 1.27e-07 54 27 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
B7N5J4 1.27e-07 54 27 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P17993 1.27e-07 54 27 4 149 1 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain K12)
B1X8C6 1.27e-07 54 27 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain K12 / DH10B)
C4ZU73 1.27e-07 54 27 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain K12 / MC4100 / BW2952)
B7UFP4 1.27e-07 54 27 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZP50 1.27e-07 54 27 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q31Z65 1.34e-07 54 27 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shigella boydii serotype 4 (strain Sb227)
B2TW20 1.34e-07 54 27 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B6I7I7 1.34e-07 54 27 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain SE11)
A8A296 1.34e-07 54 27 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O9:H4 (strain HS)
B7M5R7 1.34e-07 54 27 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O8 (strain IAI1)
B7LAP9 1.34e-07 54 27 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain 55989 / EAEC)
Q3YZX6 1.36e-07 54 27 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shigella sonnei (strain Ss046)
Q820C5 1.36e-07 54 27 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shigella flexneri
Q0T2P9 1.36e-07 54 27 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shigella flexneri serotype 5b (strain 8401)
Q1R9I4 1.36e-07 54 27 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli (strain UTI89 / UPEC)
B7MFZ8 1.36e-07 54 27 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7MXR3 1.73e-07 54 27 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O81 (strain ED1a)
C0Q093 1.75e-07 54 26 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella paratyphi C (strain RKS4594)
B5RCA1 1.75e-07 54 26 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R249 1.75e-07 54 26 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella enteritidis PT4 (strain P125109)
Q57M77 1.75e-07 54 26 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella choleraesuis (strain SC-B67)
Q0TFL0 1.76e-07 54 27 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B2VIL6 1.87e-07 53 28 4 150 3 ubiG Ubiquinone biosynthesis O-methyltransferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B6J5Y2 1.97e-07 53 30 2 103 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain CbuK_Q154)
A9KGL7 1.99e-07 53 30 2 103 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain Dugway 5J108-111)
Q820B5 2.01e-07 53 30 2 103 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NBI0 2.01e-07 53 30 2 103 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain RSA 331 / Henzerling II)
B6J1W2 2.01e-07 53 30 2 103 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain CbuG_Q212)
A3KP37 2.01e-07 54 21 4 170 2 ndufaf5 Arginine-hydroxylase NDUFAF5, mitochondrial Danio rerio
A7MPA9 2.08e-07 53 28 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Cronobacter sakazakii (strain ATCC BAA-894)
P45249 2.2e-07 53 29 4 160 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P37431 2.33e-07 53 26 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TPG0 2.33e-07 53 26 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella schwarzengrund (strain CVM19633)
B4SYU8 2.33e-07 53 26 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella newport (strain SL254)
B4TBE3 2.33e-07 53 26 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella heidelberg (strain SL476)
B5FNR7 2.33e-07 53 26 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella dublin (strain CT_02021853)
B5EYW1 2.33e-07 53 26 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella agona (strain SL483)
Q8Z560 2.36e-07 53 26 4 149 3 ubiG Ubiquinone biosynthesis O-methyltransferase Salmonella typhi
P59911 2.76e-07 53 26 7 173 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q2NSL7 2.78e-07 53 27 3 152 3 ubiG Ubiquinone biosynthesis O-methyltransferase Sodalis glossinidius (strain morsitans)
Q3SK91 3.08e-07 53 32 1 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Thiobacillus denitrificans (strain ATCC 25259)
Q3BSF8 3.12e-07 53 32 1 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q1IDA6 3.33e-07 53 31 3 110 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas entomophila (strain L48)
Q3J8U2 3.41e-07 53 28 4 152 3 ubiG Ubiquinone biosynthesis O-methyltransferase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
B6J676 4.49e-07 53 27 6 171 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Coxiella burnetii (strain CbuK_Q154)
A9WRT1 4.53e-07 52 24 2 156 3 menG Demethylmenaquinone methyltransferase Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
Q83A90 4.54e-07 53 27 6 171 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9KD75 4.54e-07 53 27 6 171 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Coxiella burnetii (strain Dugway 5J108-111)
B6J3P6 4.54e-07 53 27 6 171 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Coxiella burnetii (strain CbuG_Q212)
B0RCZ0 4.86e-07 52 22 4 191 3 menG Demethylmenaquinone methyltransferase Clavibacter sepedonicus
Q5P7U3 5.14e-07 52 34 1 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q0AA73 6.6e-07 52 33 2 104 3 ubiG Ubiquinone biosynthesis O-methyltransferase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A1K8U5 6.75e-07 52 32 3 95 3 tam Trans-aconitate 2-methyltransferase Azoarcus sp. (strain BH72)
A1TP97 7.53e-07 52 32 2 98 3 tam Trans-aconitate 2-methyltransferase Paracidovorax citrulli (strain AAC00-1)
Q4K8M4 8.77e-07 52 30 3 110 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q3K8T6 9.2e-07 52 30 3 110 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas fluorescens (strain Pf0-1)
C3K6J1 9.28e-07 52 31 2 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas fluorescens (strain SBW25)
A4SM99 9.46e-07 52 30 2 104 3 ubiG Ubiquinone biosynthesis O-methyltransferase Aeromonas salmonicida (strain A449)
C3LPS5 1.03e-06 52 23 8 200 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio cholerae serotype O1 (strain M66-2)
Q9KVQ6 1.03e-06 52 23 8 200 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F4E5 1.03e-06 52 23 8 200 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q5QZ53 1.06e-06 52 26 4 150 3 ubiG Ubiquinone biosynthesis O-methyltransferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
P65347 1.21e-06 51 31 2 106 3 BQ2027_MB0092 Uncharacterized methyltransferase Mb0092 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WK03 1.21e-06 51 31 2 106 3 Rv0089 Uncharacterized methyltransferase Rv0089 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WK02 1.21e-06 51 31 2 106 3 MT0098 Uncharacterized methyltransferase MT0098 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A3MZ07 1.22e-06 51 26 4 152 3 ubiG Ubiquinone biosynthesis O-methyltransferase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
C5BRL2 1.26e-06 51 24 7 199 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q8P8H2 1.34e-06 51 31 2 116 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RS27 1.34e-06 51 31 2 116 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas campestris pv. campestris (strain B100)
Q4UVL4 1.34e-06 51 31 2 116 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas campestris pv. campestris (strain 8004)
Q133R5 1.38e-06 51 31 3 99 3 tam Trans-aconitate 2-methyltransferase Rhodopseudomonas palustris (strain BisB5)
A9N9F4 1.62e-06 51 27 6 171 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Coxiella burnetii (strain RSA 331 / Henzerling II)
A1W9K6 1.68e-06 51 33 3 108 3 tam Trans-aconitate 2-methyltransferase Acidovorax sp. (strain JS42)
B1MHC3 1.71e-06 51 23 2 156 3 menG Demethylmenaquinone methyltransferase Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
B9MBN9 1.73e-06 51 33 3 108 3 tam Trans-aconitate 2-methyltransferase Acidovorax ebreus (strain TPSY)
Q9PAM5 2.11e-06 51 29 1 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xylella fastidiosa (strain 9a5c)
Q9HZ63 2.11e-06 50 33 2 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7V9J5 2.28e-06 50 33 2 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas aeruginosa (strain LESB58)
B0TZP1 2.4e-06 50 25 8 192 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q31GD8 2.58e-06 50 29 1 101 3 ubiG Ubiquinone biosynthesis O-methyltransferase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q02PX7 2.6e-06 50 33 2 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas aeruginosa (strain UCBPP-PA14)
A8G8B8 2.68e-06 50 23 8 207 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Serratia proteamaculans (strain 568)
B5Z1X6 2.93e-06 50 28 3 124 3 tam Trans-aconitate 2-methyltransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XAZ2 2.93e-06 50 28 3 124 3 tam Trans-aconitate 2-methyltransferase Escherichia coli O157:H7
Q216J6 3.2e-06 50 31 3 96 3 tam Trans-aconitate 2-methyltransferase Rhodopseudomonas palustris (strain BisB18)
Q7MUB2 3.4e-06 50 22 11 257 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q9CMI6 3.57e-06 50 26 4 157 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pasteurella multocida (strain Pm70)
Q10162 3.61e-06 50 28 4 139 3 bud23 18S rRNA (guanine-N(7))-methyltransferase bud23 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9CKD6 4.12e-06 50 24 7 173 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pasteurella multocida (strain Pm70)
B8F4B1 4.59e-06 50 28 2 108 3 ubiG Ubiquinone biosynthesis O-methyltransferase Glaesserella parasuis serovar 5 (strain SH0165)
Q8TJK1 4.64e-06 50 29 3 113 1 arsM Arsenite methyltransferase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q87BG5 4.68e-06 50 29 1 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I705 4.68e-06 50 29 1 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xylella fastidiosa (strain M23)
Q54818 4.72e-06 50 26 7 146 1 dnrC Aklanonic acid methyltransferase DnrC Streptomyces peucetius
Q6D7X5 4.98e-06 50 26 4 150 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A1S6C9 5.27e-06 49 24 3 155 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A6V2Q4 5.48e-06 49 33 2 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas aeruginosa (strain PA7)
Q9HUC0 5.51e-06 50 24 5 167 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02EV4 5.51e-06 50 24 5 167 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V3F6 5.51e-06 50 24 5 167 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas aeruginosa (strain LESB58)
Q3KJC5 5.61e-06 49 25 7 171 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas fluorescens (strain Pf0-1)
B1KR07 5.71e-06 49 22 6 175 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella woodyi (strain ATCC 51908 / MS32)
B3QFV9 5.77e-06 49 29 3 99 3 tam Trans-aconitate 2-methyltransferase Rhodopseudomonas palustris (strain TIE-1)
Q6N3T8 5.77e-06 49 29 3 99 3 tam Trans-aconitate 2-methyltransferase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
O74529 6.42e-06 49 29 2 103 3 SPCC70.08c Uncharacterized methyltransferase C70.08c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q12S23 6.51e-06 49 23 5 172 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B7L7L9 6.74e-06 49 27 3 124 3 tam Trans-aconitate 2-methyltransferase Escherichia coli (strain 55989 / EAEC)
Q21UL3 6.99e-06 49 33 3 109 3 ubiG Ubiquinone biosynthesis O-methyltransferase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q21IR9 7e-06 49 28 2 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q5YPB0 7.19e-06 49 23 2 156 3 menG Demethylmenaquinone methyltransferase Nocardia farcinica (strain IFM 10152)
B0U3W1 7.69e-06 49 28 1 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xylella fastidiosa (strain M12)
P65349 7.91e-06 49 27 3 131 3 BQ2027_MB3374 Uncharacterized methyltransferase Mb3374 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WK01 7.91e-06 49 27 3 131 1 Rv3342 Uncharacterized methyltransferase Rv3342 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WK00 7.91e-06 49 27 3 131 3 MT3445 Uncharacterized methyltransferase MT3445 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A1U3K1 7.95e-06 49 29 2 107 3 ubiG Ubiquinone biosynthesis O-methyltransferase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q8PK00 8.62e-06 49 31 1 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas axonopodis pv. citri (strain 306)
Q7WGT9 8.74e-06 49 25 3 151 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q07PZ6 9.46e-06 49 29 3 96 3 tam Trans-aconitate 2-methyltransferase Rhodopseudomonas palustris (strain BisA53)
Q32G05 9.79e-06 49 27 3 124 3 tam Trans-aconitate 2-methyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
A1JIF2 1.09e-05 48 22 7 190 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A3QIE1 1.11e-05 48 24 5 165 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B4S687 1.13e-05 48 25 5 174 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q9Z439 1.14e-05 48 25 6 167 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas putida
Q9RX93 1.15e-05 48 37 4 97 3 tam Trans-aconitate 2-methyltransferase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
O74421 1.24e-05 48 27 2 111 3 coq3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
C5CSI6 1.31e-05 48 32 2 96 3 tam Trans-aconitate 2-methyltransferase Variovorax paradoxus (strain S110)
Q55214 1.4e-05 48 24 5 146 1 dauC Aklanonic acid methyltransferase DauC Streptomyces sp. (strain C5)
Q7VZG7 1.45e-05 48 25 3 151 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P76145 1.48e-05 48 26 3 124 1 tam Trans-aconitate 2-methyltransferase Escherichia coli (strain K12)
B1IRU1 1.48e-05 48 26 3 124 3 tam Trans-aconitate 2-methyltransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B1XEA7 1.48e-05 48 26 3 124 3 tam Trans-aconitate 2-methyltransferase Escherichia coli (strain K12 / DH10B)
C4ZWT6 1.48e-05 48 26 3 124 3 tam Trans-aconitate 2-methyltransferase Escherichia coli (strain K12 / MC4100 / BW2952)
B1JP75 1.48e-05 48 22 7 197 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66FT0 1.48e-05 48 22 7 197 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TR39 1.48e-05 48 22 7 197 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pestis (strain Pestoides F)
Q1CNB4 1.48e-05 48 22 7 197 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pestis bv. Antiqua (strain Nepal516)
A9R431 1.48e-05 48 22 7 197 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pestis bv. Antiqua (strain Angola)
Q8D1I3 1.48e-05 48 22 7 197 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pestis
B2K0Y4 1.48e-05 48 22 7 197 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FDE0 1.48e-05 48 22 7 197 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B1J5G4 1.56e-05 48 29 3 110 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain W619)
C5C0T0 1.57e-05 48 21 4 206 3 menG Demethylmenaquinone methyltransferase Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
Q8D382 1.62e-05 48 21 5 175 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Wigglesworthia glossinidia brevipalpis
Q21H69 1.62e-05 48 23 4 169 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q1CBG0 1.63e-05 48 22 7 197 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pestis bv. Antiqua (strain Antiqua)
Q8Y0Z5 1.64e-05 48 30 1 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B3H0C8 1.64e-05 48 25 4 152 3 ubiG Ubiquinone biosynthesis O-methyltransferase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A0PLV5 1.9e-05 48 24 3 158 3 menG Demethylmenaquinone methyltransferase Mycobacterium ulcerans (strain Agy99)
B0KTX4 1.97e-05 48 30 2 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain GB-1)
Q88M10 2.06e-05 48 30 2 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W7G3 2.06e-05 48 30 2 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A8A072 2.22e-05 48 26 3 124 3 tam Trans-aconitate 2-methyltransferase Escherichia coli O9:H4 (strain HS)
P54458 2.37e-05 47 26 2 126 3 yqeM Putative methyltransferase YqeM Bacillus subtilis (strain 168)
B8EI29 2.4e-05 48 28 1 110 3 ubiG Ubiquinone biosynthesis O-methyltransferase Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q83RE0 2.42e-05 48 26 3 124 3 tam Trans-aconitate 2-methyltransferase Shigella flexneri
B6IAS2 2.44e-05 47 27 3 124 3 tam Trans-aconitate 2-methyltransferase Escherichia coli (strain SE11)
B2JEZ6 2.44e-05 47 31 1 107 3 ubiG Ubiquinone biosynthesis O-methyltransferase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q0T4L2 2.51e-05 47 26 3 124 3 tam Trans-aconitate 2-methyltransferase Shigella flexneri serotype 5b (strain 8401)
B7LZC1 2.6e-05 47 27 3 124 3 tam Trans-aconitate 2-methyltransferase Escherichia coli O8 (strain IAI1)
A7ZLX5 2.6e-05 47 27 3 124 3 tam Trans-aconitate 2-methyltransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q609G2 2.64e-05 47 28 2 108 3 ubiG Ubiquinone biosynthesis O-methyltransferase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q2L2T5 2.73e-05 47 26 4 157 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bordetella avium (strain 197N)
Q885T9 2.81e-05 47 30 2 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A1AB99 2.91e-05 47 25 3 124 3 tam Trans-aconitate 2-methyltransferase Escherichia coli O1:K1 / APEC
B2HRQ2 2.92e-05 47 24 3 158 3 menG Demethylmenaquinone methyltransferase Mycobacterium marinum (strain ATCC BAA-535 / M)
Q7NZ91 3.14e-05 47 28 3 118 3 ubiG Ubiquinone biosynthesis O-methyltransferase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q4ZQ90 3.17e-05 47 30 2 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas syringae pv. syringae (strain B728a)
Q48FM4 3.17e-05 47 30 2 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
B9JB78 3.56e-05 47 27 1 108 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q8CUK1 3.62e-05 47 24 2 125 3 OB1106 Uncharacterized methyltransferase OB1106 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B1VEN4 3.95e-05 47 21 2 152 3 menG Demethylmenaquinone methyltransferase Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
Q2K3S8 3.98e-05 47 26 1 108 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q2SE61 4.36e-05 47 30 2 104 3 ubiG Ubiquinone biosynthesis O-methyltransferase Hahella chejuensis (strain KCTC 2396)
Q5GZB5 5.34e-05 47 30 1 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SHS9 5.34e-05 47 30 1 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P2C4 5.34e-05 47 30 1 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
O80543 5.96e-05 47 22 7 225 1 At1g22800 Putative methyltransferase At1g22800, mitochondrial Arabidopsis thaliana
A4VLX7 6.1e-05 46 30 3 110 3 ubiG Ubiquinone biosynthesis O-methyltransferase Stutzerimonas stutzeri (strain A1501)
A0A0D3MJQ5 6.89e-05 46 24 7 183 1 arsM Arsenite methyltransferase Clostridium sp.
C6V598 7.15e-05 46 24 10 258 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Neorickettsia risticii (strain Illinois)
A1TSA0 8.07e-05 46 30 2 105 3 ubiG Ubiquinone biosynthesis O-methyltransferase Paracidovorax citrulli (strain AAC00-1)
Q6FDV0 8.12e-05 46 22 3 158 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
P44074 8.16e-05 46 27 5 140 4 HI_0912 Uncharacterized protein HI_0912 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8XDG3 8.51e-05 46 32 3 99 1 cmoM tRNA 5-carboxymethoxyuridine methyltransferase Escherichia coli O157:H7
P36566 8.99e-05 46 32 3 99 1 cmoM tRNA 5-carboxymethoxyuridine methyltransferase Escherichia coli (strain K12)
Q6N3Y0 9.11e-05 46 27 2 115 1 arsM Arsenite methyltransferase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q7VL11 0.000105 46 24 5 165 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9M571 0.000123 46 27 3 106 1 PEAMT Phosphoethanolamine N-methyltransferase Spinacia oleracea
Q1MBA9 0.000128 45 26 1 108 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q3T131 0.000149 45 24 3 126 2 COQ3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Bos taurus
Q6G5K3 0.000178 45 24 1 101 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q7W5Z6 0.000186 45 24 3 151 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q9XAP8 0.000194 45 21 1 156 3 menG Demethylmenaquinone methyltransferase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
B7N4U4 0.000196 45 25 3 124 3 tam Trans-aconitate 2-methyltransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q47LE2 0.000202 45 23 3 163 3 menG Demethylmenaquinone methyltransferase Thermobifida fusca (strain YX)
Q0THR9 0.000215 45 25 3 124 3 tam Trans-aconitate 2-methyltransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B5ZRR7 0.000219 45 26 1 108 3 ubiG Ubiquinone biosynthesis O-methyltransferase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
B1W525 0.000278 44 19 1 156 3 menG Demethylmenaquinone methyltransferase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
B7LRD2 0.000303 44 25 3 124 3 tam Trans-aconitate 2-methyltransferase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q0CCX8 0.00032 45 26 2 114 3 gedG Methyltransferase gedG Aspergillus terreus (strain NIH 2624 / FGSC A1156)
Q8FHF2 0.000336 44 25 3 124 3 tam Trans-aconitate 2-methyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B7URP6 0.000345 44 25 3 124 3 tam Trans-aconitate 2-methyltransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q1RBP8 0.000358 44 25 3 124 3 tam Trans-aconitate 2-methyltransferase Escherichia coli (strain UTI89 / UPEC)
B7MMY3 0.000358 44 25 3 124 3 tam Trans-aconitate 2-methyltransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
Q5KWV8 0.000366 44 22 2 149 3 GK2543 Uncharacterized methyltransferase GK2543 Geobacillus kaustophilus (strain HTA426)
A9IQF4 0.000391 44 23 2 115 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bartonella tribocorum (strain CIP 105476 / IBS 506)
A0QUV5 0.000416 44 29 3 134 1 MSMEG_2350 Probable S-adenosylmethionine-dependent methyltransferase MSMEG_2350/MSMEI_2290 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q8LBV4 0.000446 44 24 4 148 1 At1g78140 Uncharacterized methyltransferase At1g78140, chloroplastic Arabidopsis thaliana
A6VDI6 0.000552 43 25 5 167 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas aeruginosa (strain PA7)
O94628 0.000578 43 27 3 113 3 SPBC1347.09 Uncharacterized methyltransferase C1347.09 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A1URT5 0.000763 43 25 1 104 3 ubiG Ubiquinone biosynthesis O-methyltransferase Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q0HIX5 0.000826 43 25 4 155 3 ubiG Ubiquinone biosynthesis O-methyltransferase Shewanella sp. (strain MR-4)
Q1BE01 0.000854 43 22 2 151 3 menG Demethylmenaquinone methyltransferase Mycobacterium sp. (strain MCS)
A1UAY5 0.000854 43 22 2 151 3 menG Demethylmenaquinone methyltransferase Mycobacterium sp. (strain KMS)
A4JCG7 0.000879 43 31 2 112 3 ubiG Ubiquinone biosynthesis O-methyltransferase Burkholderia vietnamiensis (strain G4 / LMG 22486)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS02980
Feature type CDS
Gene bioC
Product malonyl-ACP O-methyltransferase BioC
Location 657249 - 658016 (strand: 1)
Length 768 (nucleotides) / 255 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1489
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF08241 Methyltransferase domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2226 Coenzyme transport and metabolism (H) H Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG

Kegg Ortholog Annotation(s)

Protein Sequence

MVSSIKTDKQQIAQCFSKAASHYDHHASIQRYSGDKLMYLARHQAGDRVLDAGCGTGYFSQKWRQQGRFVIALDLSHAMLQVARQQQRANCYLQSDIEHCAITPHSIDIVFSNLAMQWCDDLAIAVNSLMSVVNPQGALYFSTLATSTLQEVRDAWQFLDNHQHVNPFLSYQQIEQACSGFQYQFVTEKVTEQYASLPELFTSLKGVGANFVQGERPKGLMTRQKLRQLEQVWRKTDSGKYLLTYELVIGKISHG

Flanking regions ( +/- flanking 50bp)

AACGACTCGTCACCAAATTTCCGACATTGCGATGTTAATCGAGCTTCTTCATGGTTTCTTCAATCAAAACAGATAAACAGCAGATAGCCCAGTGTTTTAGTAAAGCGGCTAGCCATTATGATCATCATGCCTCTATTCAACGTTATAGTGGTGATAAATTGATGTATTTAGCTCGCCACCAAGCTGGGGATAGGGTGCTAGATGCGGGGTGTGGCACTGGGTATTTCAGTCAAAAATGGCGACAACAAGGACGATTTGTTATCGCACTTGATTTATCTCATGCCATGTTACAAGTGGCGAGACAACAACAACGGGCTAATTGTTATTTACAAAGTGATATTGAGCACTGTGCGATCACCCCCCACAGCATAGATATCGTTTTTAGCAATTTAGCTATGCAGTGGTGTGATGATCTTGCCATTGCGGTAAATAGCTTAATGAGTGTCGTCAATCCACAAGGGGCGCTCTATTTTTCTACGTTAGCAACATCAACGTTACAAGAGGTACGAGATGCTTGGCAGTTTCTTGATAACCACCAACATGTTAACCCGTTCCTCTCTTACCAACAGATTGAACAAGCCTGTAGTGGTTTTCAATATCAATTTGTGACTGAAAAGGTGACAGAACAATATGCATCATTGCCTGAGCTTTTTACCTCATTAAAAGGGGTAGGCGCGAATTTTGTGCAAGGAGAACGGCCAAAAGGATTAATGACACGCCAAAAACTGCGTCAATTAGAGCAAGTTTGGCGCAAAACAGACTCTGGTAAATATTTACTTACTTATGAACTCGTTATAGGAAAGATTTCTCATGGCTAAAACATGGTTTTTAACAGGAACAGATACCGAAGTCGGTAAAACCGTCGTAA