Homologs in group_1536

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_09610 FBDBKF_09610 80.7 Morganella morganii S1 bioC malonyl-ACP O-methyltransferase BioC
EHELCC_04410 EHELCC_04410 80.7 Morganella morganii S2 bioC malonyl-ACP O-methyltransferase BioC
NLDBIP_04410 NLDBIP_04410 80.7 Morganella morganii S4 bioC malonyl-ACP O-methyltransferase BioC
LHKJJB_14220 LHKJJB_14220 80.7 Morganella morganii S3 bioC malonyl-ACP O-methyltransferase BioC
HKOGLL_12315 HKOGLL_12315 80.7 Morganella morganii S5 bioC malonyl-ACP O-methyltransferase BioC
PMI_RS02980 PMI_RS02980 41.5 Proteus mirabilis HI4320 bioC malonyl-ACP O-methyltransferase BioC

Distribution of the homologs in the orthogroup group_1536

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1536

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q6D3C1 2.69e-83 253 51 1 251 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P36571 8.63e-79 241 51 1 254 1 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Serratia marcescens
C4K5L7 2.48e-74 230 45 1 255 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q7CH67 1.7e-73 228 50 1 236 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Yersinia pestis
D8MPW4 8.31e-72 223 50 2 254 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Erwinia billingiae (strain Eb661)
P12999 3.06e-65 206 47 1 254 1 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Escherichia coli (strain K12)
D2T333 1.58e-62 200 49 2 254 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Erwinia pyrifoliae (strain DSM 12163 / CIP 106111 / Ep16/96)
Q89AK7 4.65e-60 193 36 2 253 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8ZQQ6 3.53e-59 191 46 2 251 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E3G327 3.53e-59 191 45 2 254 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Enterobacter lignolyticus (strain SCF1)
O06898 1.66e-56 184 47 2 252 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Pseudescherichia vulneris
B3PI89 1.69e-44 159 37 4 257 3 bioC Biotin biosynthesis bifunctional protein BioHC Cellvibrio japonicus (strain Ueda107)
A6UYW3 4.17e-41 145 37 5 245 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Pseudomonas aeruginosa (strain PA7)
Q2SBD7 1.03e-37 137 34 7 263 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Hahella chejuensis (strain KCTC 2396)
D9SJ16 2.36e-36 133 34 8 273 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Gallionella capsiferriformans (strain ES-2)
C1D5S5 7.43e-36 132 34 8 269 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Laribacter hongkongensis (strain HLHK9)
Q5ZT34 4.35e-35 130 31 5 255 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q609U9 2.64e-34 127 34 5 243 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q47C02 1.86e-33 125 34 6 254 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Dechloromonas aromatica (strain RCB)
Q21FY5 2.52e-33 130 33 6 263 3 bioC Biotin biosynthesis bifunctional protein BioHC Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
E4QJB8 1.32e-32 124 33 8 266 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Methylovorus sp. (strain MP688)
A1WVM4 2.86e-31 120 30 6 262 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Halorhodospira halophila (strain DSM 244 / SL1)
A4G5P1 4.08e-31 119 34 8 259 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Herminiimonas arsenicoxydans
C5BMZ8 1.02e-30 123 35 8 254 3 bioC Biotin biosynthesis bifunctional protein BioHC Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q83E64 1.38e-27 110 31 7 257 3 bioC1 Malonyl-[acyl-carrier protein] O-methyltransferase 1 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
Q2Y9Y6 2.65e-27 110 30 7 275 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A6W0X8 3.1e-27 109 31 9 263 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Marinomonas sp. (strain MWYL1)
B2IAI0 1.27e-25 105 32 7 258 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Xylella fastidiosa (strain M23)
Q0VMD3 2.46e-23 99 32 9 263 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q8EDK8 2.89e-22 95 32 5 214 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
D5DIV9 5.18e-20 90 28 8 238 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Priestia megaterium (strain DSM 319 / IMG 1521)
Q818X2 8.71e-20 89 27 6 228 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
C6CWS7 1.97e-19 88 31 9 253 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Paenibacillus sp. (strain JDR-2)
E3H9W1 2.33e-19 88 25 8 247 3 bioC1 Malonyl-[acyl-carrier protein] O-methyltransferase 1 Ilyobacter polytropus (strain ATCC 51220 / DSM 2926 / LMG 16218 / CuHBu1)
Q9K623 2.26e-18 85 26 7 237 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q81MB2 1.44e-17 83 25 6 227 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Bacillus anthracis
E3HCT1 2.18e-16 79 23 8 241 3 bioC2 Malonyl-[acyl-carrier protein] O-methyltransferase 2 Ilyobacter polytropus (strain ATCC 51220 / DSM 2926 / LMG 16218 / CuHBu1)
C6V598 2.26e-16 79 26 8 257 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Neorickettsia risticii (strain Illinois)
A7GSD9 2.42e-16 80 27 7 229 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A3DBD7 8.7e-16 78 23 8 271 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q2KXN6 3.13e-15 78 35 3 169 3 bioCD Biotin biosynthesis bifunctional protein BioCD Bordetella avium (strain 197N)
C0Z787 1.92e-14 74 25 10 269 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
B2GV71 1.07e-13 73 25 5 212 2 Ndufaf5 Arginine-hydroxylase NDUFAF5, mitochondrial Rattus norvegicus
Q749W5 1.48e-13 72 27 8 271 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A2APY7 4.15e-13 71 24 5 216 1 Ndufaf5 Arginine-hydroxylase NDUFAF5, mitochondrial Mus musculus
Q5TEU4 6.97e-13 70 24 5 216 1 NDUFAF5 Arginine-hydroxylase NDUFAF5, mitochondrial Homo sapiens
Q5RBS1 9.19e-13 70 24 5 216 2 NDUFAF5 Arginine-hydroxylase NDUFAF5, mitochondrial Pongo abelii
Q7VL11 2.63e-12 68 28 9 254 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A9WRT1 1.8e-10 62 29 2 143 3 menG Demethylmenaquinone methyltransferase Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235)
Q5QYG2 2.38e-10 62 29 4 171 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B7GHW9 8.81e-10 61 25 9 233 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
A3KP37 1.06e-09 61 23 5 215 2 ndufaf5 Arginine-hydroxylase NDUFAF5, mitochondrial Danio rerio
C3LPS5 1.53e-09 60 29 6 170 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio cholerae serotype O1 (strain M66-2)
Q9KVQ6 1.53e-09 60 29 6 170 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F4E5 1.53e-09 60 29 6 170 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q7MQ33 1.74e-09 60 28 5 169 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio vulnificus (strain YJ016)
Q8DDP9 1.74e-09 60 28 5 169 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio vulnificus (strain CMCP6)
Q3B172 2.69e-09 59 26 6 218 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
P59911 3e-09 59 30 2 117 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q1GC56 3.36e-09 59 30 7 179 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Ruegeria sp. (strain TM1040)
Q6MHQ3 3.7e-09 58 29 5 151 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
C5C0T0 6.11e-09 58 27 6 213 3 menG Demethylmenaquinone methyltransferase Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / CCUG 43141 / JCM 11478 / NBRC 16432 / NCIMB 13614 / HKI 0122)
Q83CU8 9.19e-09 58 24 11 260 3 bioC2 Malonyl-[acyl-carrier protein] O-methyltransferase 2 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A8H966 9.53e-09 58 28 5 147 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A1SRS4 1.1e-08 57 31 2 106 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A9N9F4 1.19e-08 57 27 6 180 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Coxiella burnetii (strain RSA 331 / Henzerling II)
B6J676 1.19e-08 57 27 6 181 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Coxiella burnetii (strain CbuK_Q154)
B4EWC9 1.24e-08 57 27 6 172 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Proteus mirabilis (strain HI4320)
Q83A90 1.29e-08 57 27 6 181 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9KD75 1.29e-08 57 27 6 181 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Coxiella burnetii (strain Dugway 5J108-111)
B6J3P6 1.29e-08 57 27 6 181 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Coxiella burnetii (strain CbuG_Q212)
A8G8B8 1.56e-08 57 28 5 170 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Serratia proteamaculans (strain 568)
A7MQL7 1.56e-08 57 29 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cronobacter sakazakii (strain ATCC BAA-894)
A7MTX1 1.61e-08 57 26 4 165 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio campbellii (strain ATCC BAA-1116)
Q87TH4 1.62e-08 57 26 4 165 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B8CI06 2.57e-08 57 28 5 147 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella piezotolerans (strain WP3 / JCM 13877)
Q67LE6 3.04e-08 56 30 4 144 3 menG Demethylmenaquinone methyltransferase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B8E6B6 3.48e-08 56 28 6 162 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella baltica (strain OS223)
B0TJ16 3.65e-08 56 27 5 147 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella halifaxensis (strain HAW-EB4)
A1R990 5.21e-08 55 32 0 96 3 menG Demethylmenaquinone methyltransferase Paenarthrobacter aurescens (strain TC1)
A1JIF2 5.33e-08 55 29 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P64842 5.38e-08 56 27 5 192 3 BQ2027_MB1440C Uncharacterized protein Mb1440c Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WLY7 5.38e-08 56 27 5 192 1 Rv1405c Uncharacterized protein Rv1405c Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WLY6 5.38e-08 56 27 5 192 3 MT1449 Uncharacterized protein MT1449 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A6TGL3 5.92e-08 55 28 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B2VG41 6.03e-08 55 29 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B5XYI1 6.09e-08 55 28 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Klebsiella pneumoniae (strain 342)
Q6GGU0 6.41e-08 55 26 4 163 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain MRSA252)
B1JP75 6.69e-08 55 29 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66FT0 6.69e-08 55 29 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TR39 6.69e-08 55 29 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pestis (strain Pestoides F)
Q1CNB4 6.69e-08 55 29 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pestis bv. Antiqua (strain Nepal516)
A9R431 6.69e-08 55 29 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pestis bv. Antiqua (strain Angola)
Q8D1I3 6.69e-08 55 29 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pestis
B2K0Y4 6.69e-08 55 29 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FDE0 6.69e-08 55 29 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q8KF69 7.11e-08 55 25 2 140 3 menG Demethylmenaquinone methyltransferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q12S23 7.22e-08 55 27 6 162 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A9MIY3 7.29e-08 55 28 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A0PLV5 7.36e-08 55 33 4 144 3 menG Demethylmenaquinone methyltransferase Mycobacterium ulcerans (strain Agy99)
P0A2K5 7.43e-08 55 28 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2K6 7.43e-08 55 28 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella typhi
B4TNX9 7.43e-08 55 28 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella schwarzengrund (strain CVM19633)
B5BIX9 7.43e-08 55 28 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella paratyphi A (strain AKU_12601)
C0Q3E1 7.43e-08 55 28 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella paratyphi C (strain RKS4594)
A9MY97 7.43e-08 55 28 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PKP4 7.43e-08 55 28 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SZ73 7.43e-08 55 28 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella newport (strain SL254)
B4TBR3 7.43e-08 55 28 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella heidelberg (strain SL476)
B5RFM8 7.43e-08 55 28 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QW73 7.43e-08 55 28 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella enteritidis PT4 (strain P125109)
B5FNW6 7.43e-08 55 28 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella dublin (strain CT_02021853)
Q57HN8 7.43e-08 55 28 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella choleraesuis (strain SC-B67)
B5EZU8 7.43e-08 55 28 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Salmonella agona (strain SL483)
A4SGV9 7.5e-08 55 27 4 158 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q0HZP7 8.32e-08 55 28 6 162 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella sp. (strain MR-7)
Q0HEA1 8.32e-08 55 28 6 162 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella sp. (strain MR-4)
A0L1M4 8.32e-08 55 28 6 162 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella sp. (strain ANA-3)
Q9CKD6 8.45e-08 55 26 4 168 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pasteurella multocida (strain Pm70)
Q16DL1 1.08e-07 55 29 6 171 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
E4TI44 1.14e-07 54 25 4 147 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Calditerrivibrio nitroreducens (strain DSM 19672 / NBRC 101217 / Yu37-1)
C3PKL1 1.15e-07 54 33 2 112 3 menG Demethylmenaquinone methyltransferase Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
B2HRQ2 1.16e-07 54 32 4 144 3 menG Demethylmenaquinone methyltransferase Mycobacterium marinum (strain ATCC BAA-535 / M)
Q2YY85 1.21e-07 54 25 4 169 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q1CBG0 1.3e-07 54 29 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Yersinia pestis bv. Antiqua (strain Antiqua)
A8ACY2 1.35e-07 54 27 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B3QLI9 1.42e-07 54 26 2 140 3 menG Demethylmenaquinone methyltransferase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q1R477 1.47e-07 54 27 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain UTI89 / UPEC)
Q8FBJ0 1.47e-07 54 27 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TAM1 1.47e-07 54 27 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AI22 1.47e-07 54 27 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O1:K1 / APEC
B7N2E1 1.47e-07 54 27 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O81 (strain ED1a)
B7MHC0 1.47e-07 54 27 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O45:K1 (strain S88 / ExPEC)
Q9RX93 1.54e-07 54 38 3 94 3 tam Trans-aconitate 2-methyltransferase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q3YVD2 1.55e-07 54 27 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shigella sonnei (strain Ss046)
P0A889 1.55e-07 54 27 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shigella flexneri
Q0SZ25 1.55e-07 54 27 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shigella flexneri serotype 5b (strain 8401)
Q32A11 1.55e-07 54 27 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shigella dysenteriae serotype 1 (strain Sd197)
Q31UF3 1.55e-07 54 27 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shigella boydii serotype 4 (strain Sb227)
B2TVI4 1.55e-07 54 27 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LU01 1.55e-07 54 27 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LM21 1.55e-07 54 27 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain SMS-3-5 / SECEC)
B6I4H5 1.55e-07 54 27 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain SE11)
B7NFD6 1.55e-07 54 27 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A887 1.55e-07 54 27 2 118 1 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain K12)
B1IW72 1.55e-07 54 27 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A6U0 1.55e-07 54 27 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O9:H4 (strain HS)
B1XAJ7 1.55e-07 54 27 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain K12 / DH10B)
C5A009 1.55e-07 54 27 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain K12 / MC4100 / BW2952)
B7M638 1.55e-07 54 27 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O8 (strain IAI1)
B7NV33 1.55e-07 54 27 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YY82 1.55e-07 54 27 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A888 1.55e-07 54 27 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O157:H7
B7L996 1.55e-07 54 27 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli (strain 55989 / EAEC)
B7UNG3 1.55e-07 54 27 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZU40 1.55e-07 54 27 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Escherichia coli O139:H28 (strain E24377A / ETEC)
Q5X0X6 1.65e-07 54 26 4 167 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Legionella pneumophila (strain Paris)
Q5ZRH9 1.78e-07 54 26 4 167 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
P67063 1.79e-07 54 25 4 169 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain MW2)
A8Z450 1.79e-07 54 25 4 169 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain USA300 / TCH1516)
Q6G992 1.79e-07 54 25 4 169 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain MSSA476)
P67062 1.79e-07 54 25 4 169 1 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain N315)
P67061 1.79e-07 54 25 4 169 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QH20 1.79e-07 54 25 4 169 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain Newman)
Q5HFV2 1.79e-07 54 25 4 169 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain COL)
A5ISZ9 1.79e-07 54 25 4 169 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain JH9)
A6U1T9 1.79e-07 54 25 4 169 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain JH1)
A7X2H6 1.79e-07 54 25 4 169 3 menG Demethylmenaquinone methyltransferase Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q5WSQ8 1.92e-07 54 26 4 167 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Legionella pneumophila (strain Lens)
A9KYL8 2.02e-07 54 27 6 162 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella baltica (strain OS195)
A6WIE9 2.02e-07 54 27 6 162 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella baltica (strain OS185)
A3D9F2 2.02e-07 54 27 6 162 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella baltica (strain OS155 / ATCC BAA-1091)
C1DHS2 2.43e-07 53 30 4 120 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q7MZ81 2.56e-07 53 28 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8E9R7 2.63e-07 53 27 6 162 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A5II90 3.13e-07 53 28 4 156 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Legionella pneumophila (strain Corby)
B1KR07 3.33e-07 53 27 5 147 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella woodyi (strain ATCC 51908 / MS32)
A4VGE5 3.39e-07 53 27 6 173 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Stutzerimonas stutzeri (strain A1501)
Q7MUB2 3.8e-07 53 26 10 271 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q9XAP8 4.04e-07 53 27 2 155 3 menG Demethylmenaquinone methyltransferase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
A0AK43 4.46e-07 53 27 3 131 3 menG Demethylmenaquinone methyltransferase Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
A1RP78 4.95e-07 53 26 5 165 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella sp. (strain W3-18-1)
A4Y2Q5 4.95e-07 53 26 5 165 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
P67055 4.99e-07 52 27 3 131 3 menG Demethylmenaquinone methyltransferase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71Y84 4.99e-07 52 27 3 131 3 menG Demethylmenaquinone methyltransferase Listeria monocytogenes serotype 4b (strain F2365)
C1KWN1 4.99e-07 52 27 3 131 3 menG Demethylmenaquinone methyltransferase Listeria monocytogenes serotype 4b (strain CLIP80459)
P67056 4.99e-07 52 27 3 131 3 menG Demethylmenaquinone methyltransferase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A1SAJ8 5.09e-07 53 27 5 161 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A4WFY5 6.2e-07 52 27 2 118 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Enterobacter sp. (strain 638)
A3QIE1 6.5e-07 52 30 2 99 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q58DP0 7.32e-07 52 40 1 70 2 BUD23 18S rRNA (guanine-N(7))-methyltransferase Bos taurus
A1BAN1 7.51e-07 52 27 4 163 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Paracoccus denitrificans (strain Pd 1222)
Q088H8 7.56e-07 52 27 6 169 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella frigidimarina (strain NCIMB 400)
Q9HUC0 7.96e-07 52 27 7 180 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02EV4 7.96e-07 52 27 7 180 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V3F6 7.96e-07 52 27 7 180 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas aeruginosa (strain LESB58)
A8G0S7 9.2e-07 52 26 5 147 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Shewanella sediminis (strain HAW-EB3)
Q55423 9.9e-07 51 30 1 97 3 sll0829 Uncharacterized methyltransferase sll0829 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8TJK1 1.04e-06 52 28 3 115 1 arsM Arsenite methyltransferase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
Q8CSH9 1.06e-06 52 33 3 115 3 menG Demethylmenaquinone methyltransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HP74 1.06e-06 52 33 3 115 3 menG Demethylmenaquinone methyltransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
C5BCA4 1.14e-06 52 26 4 165 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Edwardsiella ictaluri (strain 93-146)
Q24W96 1.15e-06 52 30 2 116 3 menG Demethylmenaquinone methyltransferase Desulfitobacterium hafniense (strain Y51)
Q1BE01 1.16e-06 51 31 4 153 3 menG Demethylmenaquinone methyltransferase Mycobacterium sp. (strain MCS)
A1UAY5 1.16e-06 51 31 4 153 3 menG Demethylmenaquinone methyltransferase Mycobacterium sp. (strain KMS)
A3PUJ1 1.16e-06 51 31 4 153 3 menG Demethylmenaquinone methyltransferase Mycobacterium sp. (strain JLS)
B8DBZ5 1.69e-06 51 27 3 131 3 menG Demethylmenaquinone methyltransferase Listeria monocytogenes serotype 4a (strain HCC23)
Q1LRG9 1.71e-06 51 27 5 151 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
P65349 2.47e-06 50 31 1 92 3 BQ2027_MB3374 Uncharacterized methyltransferase Mb3374 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WK01 2.47e-06 50 31 1 92 1 Rv3342 Uncharacterized methyltransferase Rv3342 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WK00 2.47e-06 50 31 1 92 3 MT3445 Uncharacterized methyltransferase MT3445 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q6N3Y0 2.64e-06 51 30 4 124 1 arsM Arsenite methyltransferase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q3IJV7 2.97e-06 50 25 4 164 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudoalteromonas translucida (strain TAC 125)
C4LL93 3.09e-06 50 28 3 142 3 menG Demethylmenaquinone methyltransferase Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
P49016 3.4e-06 50 28 4 172 3 menG Demethylmenaquinone methyltransferase Lactococcus lactis subsp. lactis (strain IL1403)
C6DI77 3.48e-06 50 24 5 169 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B4S687 4.17e-06 50 25 4 160 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
O43709 4.35e-06 50 40 1 70 1 BUD23 18S rRNA (guanine-N(7))-methyltransferase Homo sapiens
Q0KEH6 4.89e-06 50 27 5 151 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q49XS5 5.25e-06 49 25 5 149 3 menG Demethylmenaquinone methyltransferase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
A5UVB2 5.44e-06 49 31 3 98 3 menG Demethylmenaquinone methyltransferase Roseiflexus sp. (strain RS-1)
Q6DAQ7 5.6e-06 50 26 6 171 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8EXJ3 5.85e-06 49 33 4 112 3 menG Demethylmenaquinone methyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q75FL1 5.85e-06 49 33 4 112 3 menG Demethylmenaquinone methyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
E1WTS2 6.01e-06 50 24 9 251 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Bacteroides fragilis (strain 638R)
Q8CWG0 6.94e-06 49 26 2 115 3 menG Demethylmenaquinone methyltransferase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A4QBE5 7.26e-06 49 29 3 142 3 menG Demethylmenaquinone methyltransferase Corynebacterium glutamicum (strain R)
Q65I24 7.58e-06 49 32 4 103 3 menG Demethylmenaquinone methyltransferase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q3KJC5 7.7e-06 49 25 5 184 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas fluorescens (strain Pf0-1)
Q8NT39 7.97e-06 49 29 3 142 3 menG Demethylmenaquinone methyltransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4WVR7 8.01e-06 49 29 7 173 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
B2AH07 8.03e-06 49 27 5 151 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
A4XPM7 8.29e-06 49 25 6 182 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas mendocina (strain ymp)
Q64VX6 8.73e-06 50 24 9 252 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Bacteroides fragilis (strain YCH46)
Q475X0 8.98e-06 49 27 5 151 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q4L6H3 9.16e-06 49 23 5 168 3 menG Demethylmenaquinone methyltransferase Staphylococcus haemolyticus (strain JCSC1435)
A8LNK7 9.92e-06 49 26 3 162 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
C1DCV3 1.02e-05 49 27 6 155 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Laribacter hongkongensis (strain HLHK9)
A6VDI6 1.04e-05 49 28 6 157 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas aeruginosa (strain PA7)
A1TP97 1.1e-05 49 31 2 97 3 tam Trans-aconitate 2-methyltransferase Paracidovorax citrulli (strain AAC00-1)
A0L3L9 1.12e-05 49 30 6 156 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A1AB99 1.23e-05 48 31 3 94 3 tam Trans-aconitate 2-methyltransferase Escherichia coli O1:K1 / APEC
B1JYJ6 1.34e-05 48 28 5 145 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia orbicola (strain MC0-3)
B4EBC4 1.34e-05 48 28 5 145 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
B9KQJ8 1.35e-05 48 29 6 158 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3IY65 1.35e-05 48 29 6 158 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PFL1 1.35e-05 48 29 6 158 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q1BTN4 1.39e-05 48 28 5 145 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia orbicola (strain AU 1054)
A0KAF5 1.39e-05 48 28 5 145 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia cenocepacia (strain HI2424)
Q0BBY4 1.46e-05 48 28 5 145 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YWF9 1.46e-05 48 28 5 145 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia ambifaria (strain MC40-6)
A1SE26 1.61e-05 48 29 5 154 3 menG Demethylmenaquinone methyltransferase Nocardioides sp. (strain ATCC BAA-499 / JS614)
O66128 1.71e-05 48 25 2 114 3 menG Demethylmenaquinone methyltransferase Micrococcus luteus
Q39D13 1.74e-05 48 28 5 145 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
P65347 1.83e-05 47 31 2 104 3 BQ2027_MB0092 Uncharacterized methyltransferase Mb0092 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WK03 1.83e-05 47 31 2 104 3 Rv0089 Uncharacterized methyltransferase Rv0089 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WK02 1.83e-05 47 31 2 104 3 MT0098 Uncharacterized methyltransferase MT0098 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A0PQ29 1.99e-05 48 34 3 101 3 MUL_2009 Probable phthiotriol/phenolphthiotriol dimycocerosates methyltransferase 2 Mycobacterium ulcerans (strain Agy99)
O74529 2.08e-05 48 25 4 137 3 SPCC70.08c Uncharacterized methyltransferase C70.08c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q21H69 2.13e-05 48 25 5 168 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B9LZA9 2.19e-05 48 32 3 107 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
Q54VN2 2.25e-05 48 27 2 114 3 coq5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Dictyostelium discoideum
Q66L51 2.27e-05 48 33 3 95 2 coq5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Danio rerio
Q88D17 2.35e-05 48 25 6 178 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5WA45 2.35e-05 48 25 6 178 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q9CY21 2.68e-05 48 38 1 70 1 Bud23 18S rRNA (guanine-N(7))-methyltransferase Mus musculus
A7NF26 3.01e-05 47 36 5 99 3 menG Demethylmenaquinone methyltransferase Roseiflexus castenholzii (strain DSM 13941 / HLO8)
Q47LE2 3.14e-05 47 28 3 152 3 menG Demethylmenaquinone methyltransferase Thermobifida fusca (strain YX)
Q81ZX2 3.36e-05 47 25 2 155 3 menG Demethylmenaquinone methyltransferase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q5YPB0 3.7e-05 47 29 4 145 3 menG Demethylmenaquinone methyltransferase Nocardia farcinica (strain IFM 10152)
A9KGL7 3.73e-05 47 27 2 122 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain Dugway 5J108-111)
P54458 3.93e-05 47 31 4 117 3 yqeM Putative methyltransferase YqeM Bacillus subtilis (strain 168)
B0RCZ0 3.96e-05 47 26 3 157 3 menG Demethylmenaquinone methyltransferase Clavibacter sepedonicus
B8IJ00 4.04e-05 47 28 7 174 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q820B5 4.17e-05 47 27 2 122 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NBI0 4.17e-05 47 27 2 122 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain RSA 331 / Henzerling II)
B6J1W2 4.17e-05 47 27 2 122 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain CbuG_Q212)
B6J5Y2 4.17e-05 47 27 2 122 3 ubiG Ubiquinone biosynthesis O-methyltransferase Coxiella burnetii (strain CbuK_Q154)
A4IXH9 4.19e-05 47 26 5 168 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Francisella tularensis subsp. tularensis (strain WY96-3418)
Q1QS47 4.22e-05 47 30 4 129 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
B2SFA2 4.43e-05 47 26 5 168 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Francisella tularensis subsp. mediasiatica (strain FSC147)
Q87UZ2 4.48e-05 47 25 6 178 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4ZZG3 4.53e-05 47 25 6 178 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas syringae pv. syringae (strain B728a)
Q48PJ4 4.53e-05 47 25 6 178 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A0Q549 4.55e-05 47 26 5 168 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Francisella tularensis subsp. novicida (strain U112)
A6VTA1 4.66e-05 47 24 5 173 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Marinomonas sp. (strain MWYL1)
B0TZP1 4.68e-05 47 26 5 168 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
P45249 4.97e-05 47 23 6 246 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q0BNE2 4.99e-05 47 26 5 168 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Francisella tularensis subsp. holarctica (strain OSU18)
Q2A524 4.99e-05 47 26 5 168 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Francisella tularensis subsp. holarctica (strain LVS)
A7NAA1 4.99e-05 47 26 5 168 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
B7GHP8 5.08e-05 47 25 3 130 3 menG Demethylmenaquinone methyltransferase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
B1W525 5.18e-05 47 25 0 108 3 menG Demethylmenaquinone methyltransferase Streptomyces griseus subsp. griseus (strain JCM 4626 / CBS 651.72 / NBRC 13350 / KCC S-0626 / ISP 5235)
P30866 5.23e-05 46 34 3 87 3 yafE Uncharacterized protein YafE Escherichia coli (strain K12)
A5FZ96 5.35e-05 47 26 5 171 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Acidiphilium cryptum (strain JF-5)
Q88SI6 5.73e-05 47 26 4 141 3 menG Demethylmenaquinone methyltransferase Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q0AA73 5.97e-05 47 30 2 101 3 ubiG Ubiquinone biosynthesis O-methyltransferase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q73SL8 6.07e-05 46 33 2 110 3 menG Demethylmenaquinone methyltransferase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A7Z627 6.79e-05 46 27 2 115 3 menG Demethylmenaquinone methyltransferase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B1VEN4 7.04e-05 46 32 1 97 3 menG Demethylmenaquinone methyltransferase Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
Q8FSB3 7.31e-05 46 28 3 144 3 menG Demethylmenaquinone methyltransferase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A1U9D7 7.38e-05 46 32 2 94 3 Mkms_0228 Uncharacterized methyltransferase Mkms_0228 Mycobacterium sp. (strain KMS)
Q1BFJ5 7.38e-05 46 32 2 94 3 Mmcs_0218 Uncharacterized methyltransferase Mmcs_0218 Mycobacterium sp. (strain MCS)
B8EI29 7.81e-05 46 30 5 136 3 ubiG Ubiquinone biosynthesis O-methyltransferase Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
B1J2S8 8.33e-05 46 24 6 178 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas putida (strain W619)
P20187 9.01e-05 46 29 5 137 3 None Uncharacterized 37.1 kDa protein in transposon TN4556 Streptomyces fradiae
Q9CD86 9.12e-05 46 35 1 78 3 ML0130 Phthiotriol/phenolphthiotriol dimycocerosates methyltransferase Mycobacterium leprae (strain TN)
P9WFR3 9.65e-05 46 29 3 154 1 menG Demethylmenaquinone methyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFR2 9.65e-05 46 29 3 154 3 menG Demethylmenaquinone methyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5TZT8 9.65e-05 46 29 3 154 3 menG Demethylmenaquinone methyltransferase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AKN8 9.65e-05 46 29 3 154 3 menG Demethylmenaquinone methyltransferase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KG35 9.65e-05 46 29 3 154 3 menG Demethylmenaquinone methyltransferase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P0A639 9.65e-05 46 29 3 154 3 menG Demethylmenaquinone methyltransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
B2IUM7 9.85e-05 46 29 2 101 3 menG 2-phytyl-1,4-naphtoquinone methyltransferase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q5NFE1 9.9e-05 46 28 5 148 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14GU4 9.9e-05 46 28 5 148 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Francisella tularensis subsp. tularensis (strain FSC 198)
Q1I3T0 0.000105 46 24 6 178 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas entomophila (strain L48)
Q9Z439 0.00011 46 24 6 178 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Pseudomonas putida
A3PSZ4 0.000111 46 32 2 94 3 Mjls_0208 Uncharacterized methyltransferase Mjls_0208 Mycobacterium sp. (strain JLS)
A1T1P0 0.000111 46 30 1 95 3 Mvan_0241 Uncharacterized methyltransferase Mvan_0241 Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
O14321 0.000121 46 27 2 96 2 erg6 Sterol 24-C-methyltransferase erg6 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
A4WAG4 0.000128 45 29 3 92 3 tam Trans-aconitate 2-methyltransferase Enterobacter sp. (strain 638)
Q5WGT4 0.000131 45 27 3 115 3 menG Demethylmenaquinone methyltransferase Shouchella clausii (strain KSM-K16)
B3Q619 0.000138 45 26 6 181 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rhodopseudomonas palustris (strain TIE-1)
Q6NDM2 0.000138 45 26 6 181 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A0A0D3MJQ5 0.000163 45 28 2 103 1 arsM Arsenite methyltransferase Clostridium sp.
Q2T139 0.000163 45 27 6 160 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63XA0 0.000163 45 27 6 160 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia pseudomallei (strain K96243)
A3N5U8 0.000163 45 27 6 160 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia pseudomallei (strain 668)
Q3JVZ6 0.000163 45 27 6 160 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia pseudomallei (strain 1710b)
A3NRJ4 0.000163 45 27 6 160 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia pseudomallei (strain 1106a)
A1V753 0.000163 45 27 6 160 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia mallei (strain SAVP1)
Q62MP4 0.000163 45 27 6 160 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia mallei (strain ATCC 23344)
A2S8L1 0.000163 45 27 6 160 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia mallei (strain NCTC 10229)
A3MNT8 0.000163 45 27 6 160 3 ubiE Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE Burkholderia mallei (strain NCTC 10247)
O52025 0.000182 45 32 3 103 2 arsM Arsenite methyltransferase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
A0QRH1 0.0002 45 30 5 157 3 menG Demethylmenaquinone methyltransferase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q3K8T6 0.000222 45 28 2 111 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas fluorescens (strain Pf0-1)
B7L7L9 0.000223 45 29 3 94 3 tam Trans-aconitate 2-methyltransferase Escherichia coli (strain 55989 / EAEC)
Q4K8M4 0.00023 45 28 2 111 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A4T183 0.000237 45 29 5 161 3 menG Demethylmenaquinone methyltransferase Mycolicibacterium gilvum (strain PYR-GCK)
Q9CBA8 0.000259 44 29 3 155 3 menG Demethylmenaquinone methyltransferase Mycobacterium leprae (strain TN)
A1T3S1 0.000268 44 32 2 110 3 menG Demethylmenaquinone methyltransferase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q0P5A2 0.000306 45 30 2 93 2 COQ5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial Bos taurus
B0UPF4 0.00033 44 33 2 93 3 tam Trans-aconitate 2-methyltransferase Methylobacterium sp. (strain 4-46)
B7LZC1 0.000344 44 29 3 94 3 tam Trans-aconitate 2-methyltransferase Escherichia coli O8 (strain IAI1)
A7ZLX5 0.000344 44 29 3 94 3 tam Trans-aconitate 2-methyltransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q0VZ70 0.000349 45 30 5 140 1 cmdD Chondramide synthase cmdD Chondromyces crocatus
Q83RE0 0.000378 44 29 3 94 3 tam Trans-aconitate 2-methyltransferase Shigella flexneri
Q0T4L2 0.000381 44 29 3 94 3 tam Trans-aconitate 2-methyltransferase Shigella flexneri serotype 5b (strain 8401)
B6IAS2 0.000381 44 29 3 94 3 tam Trans-aconitate 2-methyltransferase Escherichia coli (strain SE11)
A4T3V1 0.00039 44 29 1 95 3 Mflv_0427 Uncharacterized methyltransferase Mflv_0427 Mycolicibacterium gilvum (strain PYR-GCK)
B5Z1X6 0.000403 44 29 3 94 3 tam Trans-aconitate 2-methyltransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XAZ2 0.000403 44 29 3 94 3 tam Trans-aconitate 2-methyltransferase Escherichia coli O157:H7
Q32G05 0.000442 44 29 3 94 3 tam Trans-aconitate 2-methyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
O74421 0.000501 44 25 5 156 3 coq3 Ubiquinone biosynthesis O-methyltransferase, mitochondrial Schizosaccharomyces pombe (strain 972 / ATCC 24843)
B2VIL6 0.000552 43 30 3 110 3 ubiG Ubiquinone biosynthesis O-methyltransferase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q1IDA6 0.000581 43 27 2 111 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas entomophila (strain L48)
B1J5G4 0.00062 43 27 2 111 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain W619)
Q88M10 0.00062 43 27 2 111 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5W7G3 0.00062 43 27 2 111 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B0KTX4 0.000626 43 27 2 111 3 ubiG Ubiquinone biosynthesis O-methyltransferase Pseudomonas putida (strain GB-1)
Q609G2 0.000644 43 31 5 128 3 ubiG Ubiquinone biosynthesis O-methyltransferase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q5N4X9 0.000647 43 33 3 101 3 menG 2-phytyl-1,4-naphtoquinone methyltransferase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31P90 0.000647 43 33 3 101 3 menG 2-phytyl-1,4-naphtoquinone methyltransferase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q96WX4 0.000651 44 28 2 98 1 erg6 Sterol 24-C-methyltransferase Pneumocystis carinii (strain B80)
A0QUV5 0.000708 43 26 0 94 1 MSMEG_2350 Probable S-adenosylmethionine-dependent methyltransferase MSMEG_2350/MSMEI_2290 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q8LBV4 0.00072 43 29 4 124 1 At1g78140 Uncharacterized methyltransferase At1g78140, chloroplastic Arabidopsis thaliana
P0CT10 0.00078 43 31 2 97 3 ERG6 Sterol 24-C-methyltransferase Pyricularia oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)
L7IP31 0.00078 43 31 2 97 2 ERG6 Sterol 24-C-methyltransferase Pyricularia oryzae (strain Y34)
P67064 0.000827 43 29 3 103 3 menG Demethylmenaquinone methyltransferase Tropheryma whipplei (strain Twist)
P67065 0.000827 43 29 3 103 3 menG Demethylmenaquinone methyltransferase Tropheryma whipplei (strain TW08/27)
Q6FDV0 0.000859 43 24 11 266 3 bioC Malonyl-[acyl-carrier protein] O-methyltransferase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS00730
Feature type CDS
Gene bioC
Product malonyl-ACP O-methyltransferase BioC
Location 152211 - 153005 (strand: 1)
Length 795 (nucleotides) / 264 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000001
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1536
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF08241 Methyltransferase domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2226 Coenzyme transport and metabolism (H) H Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG

Kegg Ortholog Annotation(s)

Protein Sequence

MHSAVNIVPVNKAAVAAAFGRAAGQYDAVAHLQQQTGKHLYSLTKQRLRPQQLTQLHGLDAGCGTGFFSEQWKAECGSITAFDLSPAMLEHARAQQRASCYVQGDIEQLPFADNQFDFCFSNLAVQWCDSLSAALAGLFRVTRPGGTVAFSTLSTGSLAELNQAFSCVDSARHANGFLSRDAIRAACQPYHYTLSDVQYRLTFSSLPALLHSLKGIGATHVHQGRSAGLMTRNKLAQLAAHYPAENGEYPLSYSIQYGVIHVEK

Flanking regions ( +/- flanking 50bp)

CACCAGCGCTCATCAGAAAGCGGATATCACCTTACTTACGGAGGCGCTGGATGCATTCTGCTGTCAATATCGTCCCGGTGAATAAAGCGGCGGTTGCCGCTGCATTCGGGCGTGCGGCGGGGCAATATGATGCTGTCGCACATCTCCAGCAGCAGACCGGGAAACACTTGTACAGCCTGACGAAACAAAGGCTCCGCCCACAGCAACTGACTCAGTTGCACGGGCTGGATGCAGGGTGCGGCACCGGGTTTTTCAGTGAGCAATGGAAAGCGGAGTGCGGATCGATTACCGCGTTTGATCTGTCACCGGCAATGCTGGAACACGCCCGCGCGCAGCAACGTGCAAGCTGCTATGTTCAGGGCGACATTGAACAGTTGCCGTTTGCGGATAATCAGTTTGATTTCTGTTTCAGTAATCTTGCGGTGCAGTGGTGTGATTCCCTGAGCGCCGCACTGGCCGGGTTGTTTCGTGTTACGCGTCCGGGCGGTACGGTGGCATTTTCCACCCTCAGCACCGGCTCATTAGCAGAGCTTAATCAGGCATTTTCCTGTGTCGACAGTGCGCGCCACGCCAACGGTTTTCTGAGCCGGGATGCTATCCGGGCTGCCTGTCAGCCATATCACTATACTCTGTCTGACGTGCAATACCGGCTTACCTTTTCATCCCTGCCCGCACTGTTGCACTCCCTCAAAGGGATTGGTGCGACGCATGTGCATCAGGGGCGCAGCGCCGGGCTGATGACGCGCAATAAGCTGGCACAGCTTGCGGCACACTATCCGGCAGAAAACGGGGAATACCCGCTCAGTTACAGTATTCAGTACGGAGTTATTCATGTTGAAAAATAATTGGTTTTTAACCGGCACAGATACAGATGCCGGAAAAACCGTGGTCAGTT