Homologs in group_1559

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10100 FBDBKF_10100 83.9 Morganella morganii S1 ybeD DUF493 domain-containing protein
EHELCC_04900 EHELCC_04900 83.9 Morganella morganii S2 ybeD DUF493 domain-containing protein
NLDBIP_04900 NLDBIP_04900 83.9 Morganella morganii S4 ybeD DUF493 domain-containing protein
LHKJJB_13730 LHKJJB_13730 83.9 Morganella morganii S3 ybeD DUF493 domain-containing protein
HKOGLL_12805 HKOGLL_12805 83.9 Morganella morganii S5 ybeD DUF493 domain-containing protein
F4V73_RS00235 F4V73_RS00235 81.6 Morganella psychrotolerans ybeD DUF493 family protein YbeD

Distribution of the homologs in the orthogroup group_1559

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1559

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
C5BGD7 6.84e-54 165 88 0 87 3 NT01EI_2946 UPF0250 protein NT01EI_2946 Edwardsiella ictaluri (strain 93-146)
Q7N765 3.92e-53 163 88 0 87 3 plu1293 UPF0250 protein plu1293 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8GB11 1.93e-52 161 86 0 87 3 Spro_1197 UPF0250 protein Spro_1197 Serratia proteamaculans (strain 568)
Q3Z4G1 3.26e-52 160 86 0 87 3 ybeD UPF0250 protein YbeD Shigella sonnei (strain Ss046)
P0A8J7 3.26e-52 160 86 0 87 3 ybeD UPF0250 protein YbeD Shigella flexneri
Q0T6P1 3.26e-52 160 86 0 87 3 ybeD UPF0250 protein YbeD Shigella flexneri serotype 5b (strain 8401)
Q32IU9 3.26e-52 160 86 0 87 3 ybeD UPF0250 protein YbeD Shigella dysenteriae serotype 1 (strain Sd197)
Q324R2 3.26e-52 160 86 0 87 3 ybeD UPF0250 protein YbeD Shigella boydii serotype 4 (strain Sb227)
B2TU87 3.26e-52 160 86 0 87 3 ybeD UPF0250 protein YbeD Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LLI1 3.26e-52 160 86 0 87 3 ybeD UPF0250 protein YbeD Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1RET1 3.26e-52 160 86 0 87 3 ybeD UPF0250 protein YbeD Escherichia coli (strain UTI89 / UPEC)
B1LKM2 3.26e-52 160 86 0 87 3 ybeD UPF0250 protein YbeD Escherichia coli (strain SMS-3-5 / SECEC)
B6I140 3.26e-52 160 86 0 87 3 ybeD UPF0250 protein YbeD Escherichia coli (strain SE11)
B7N9N7 3.26e-52 160 86 0 87 3 ybeD UPF0250 protein YbeD Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8J4 3.26e-52 160 86 0 87 1 ybeD UPF0250 protein YbeD Escherichia coli (strain K12)
B1IYH7 3.26e-52 160 86 0 87 3 ybeD UPF0250 protein YbeD Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A8J5 3.26e-52 160 86 0 87 3 ybeD UPF0250 protein YbeD Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TK42 3.26e-52 160 86 0 87 3 ybeD UPF0250 protein YbeD Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A8Q6 3.26e-52 160 86 0 87 3 ybeD UPF0250 protein YbeD Escherichia coli O1:K1 / APEC
A7ZXQ8 3.26e-52 160 86 0 87 3 ybeD UPF0250 protein YbeD Escherichia coli O9:H4 (strain HS)
C4ZWB8 3.26e-52 160 86 0 87 3 ybeD UPF0250 protein YbeD Escherichia coli (strain K12 / MC4100 / BW2952)
B7M5F8 3.26e-52 160 86 0 87 3 ybeD UPF0250 protein YbeD Escherichia coli O8 (strain IAI1)
B7MRR8 3.26e-52 160 86 0 87 3 ybeD UPF0250 protein YbeD Escherichia coli O81 (strain ED1a)
B7NLZ0 3.26e-52 160 86 0 87 3 ybeD UPF0250 protein YbeD Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YQI2 3.26e-52 160 86 0 87 3 ybeD UPF0250 protein YbeD Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A8J6 3.26e-52 160 86 0 87 3 ybeD UPF0250 protein YbeD Escherichia coli O157:H7
B7L9H5 3.26e-52 160 86 0 87 3 ybeD UPF0250 protein YbeD Escherichia coli (strain 55989 / EAEC)
B7MFQ4 3.26e-52 160 86 0 87 3 ybeD UPF0250 protein YbeD Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UKS1 3.26e-52 160 86 0 87 3 ybeD UPF0250 protein YbeD Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZJ19 3.26e-52 160 86 0 87 3 ybeD UPF0250 protein YbeD Escherichia coli O139:H28 (strain E24377A / ETEC)
A6T692 6.1e-52 160 86 0 87 3 KPN78578_06520 UPF0250 protein KPN78578_06520 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XZS3 6.1e-52 160 86 0 87 3 KPK_3910 UPF0250 protein KPK_3910 Klebsiella pneumoniae (strain 342)
Q2NUV6 6.73e-52 159 85 0 87 3 SG0794 UPF0250 protein SG0794 Sodalis glossinidius (strain morsitans)
B1JGB5 6.73e-52 159 86 0 87 3 YPK_3025 UPF0250 protein YPK_3025 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FKY7 6.73e-52 159 86 0 87 3 YpsIP31758_2953 UPF0250 protein YpsIP31758_2953 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A4TP07 6.73e-52 159 86 0 87 3 YPDSF_2653 UPF0250 protein YPDSF_2653 Yersinia pestis (strain Pestoides F)
Q8ZDG8 6.73e-52 159 86 0 87 3 YPO2600 UPF0250 protein YPO2600/y1174/YP_1113 Yersinia pestis
Q1C509 6.73e-52 159 86 0 87 3 YPA_2499 UPF0250 protein YPA_2499 Yersinia pestis bv. Antiqua (strain Antiqua)
A9R701 6.73e-52 159 86 0 87 3 YpAngola_A1853 UPF0250 protein YpAngola_A1853 Yersinia pestis bv. Antiqua (strain Angola)
B2K876 6.73e-52 159 86 0 87 3 YPTS_1150 UPF0250 protein YPTS_1150 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q66DF3 6.73e-52 159 86 0 87 3 YPTB1093 UPF0250 protein YPTB1093 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CKR4 6.73e-52 159 86 0 87 3 YPN_1085 UPF0250 protein YPN_1085 Yersinia pestis bv. Antiqua (strain Nepal516)
A4W817 1.34e-51 159 85 0 87 3 Ent638_1166 UPF0250 protein Ent638_1166 Enterobacter sp. (strain 638)
P67537 1.48e-51 159 85 0 87 3 ybeD UPF0250 protein YbeD Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P67538 1.48e-51 159 85 0 87 3 ybeD UPF0250 protein YbeD Salmonella typhi
B4TPA7 1.48e-51 159 85 0 87 3 ybeD UPF0250 protein YbeD Salmonella schwarzengrund (strain CVM19633)
B5BCF8 1.48e-51 159 85 0 87 3 ybeD UPF0250 protein YbeD Salmonella paratyphi A (strain AKU_12601)
Q5PMA0 1.48e-51 159 85 0 87 3 ybeD UPF0250 protein YbeD Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SYJ4 1.48e-51 159 85 0 87 3 ybeD UPF0250 protein YbeD Salmonella newport (strain SL254)
B4TAI9 1.48e-51 159 85 0 87 3 ybeD UPF0250 protein YbeD Salmonella heidelberg (strain SL476)
B5R7Y4 1.48e-51 159 85 0 87 3 ybeD UPF0250 protein YbeD Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QVN7 1.48e-51 159 85 0 87 3 ybeD UPF0250 protein YbeD Salmonella enteritidis PT4 (strain P125109)
B5FMN2 1.48e-51 159 85 0 87 3 ybeD UPF0250 protein YbeD Salmonella dublin (strain CT_02021853)
A9MKE1 1.48e-51 159 85 0 87 3 ybeD UPF0250 protein YbeD Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5EZ76 1.48e-51 159 85 0 87 3 ybeD UPF0250 protein YbeD Salmonella agona (strain SL483)
A8AJH3 1.48e-51 159 85 0 87 3 CKO_02527 UPF0250 protein CKO_02527 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A1JPR7 1.6e-51 159 86 0 87 3 YE3006 UPF0250 protein YE3006 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B2VBJ9 5.73e-51 157 85 0 87 3 ETA_23570 UPF0250 protein ETA_23570 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q9KTF7 2.1e-47 148 81 0 85 3 VC_0945 UPF0250 protein VC_0945 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
C3LTJ3 2.1e-47 148 81 0 85 3 VCM66_0901 UPF0250 protein VCM66_0901 Vibrio cholerae serotype O1 (strain M66-2)
A5F2Y2 2.1e-47 148 81 0 85 3 VC0395_A0469 UPF0250 protein VC0395_A0469/VC395_0960 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A7MY91 3.05e-47 148 80 0 85 3 VIBHAR_01213 UPF0250 protein VIBHAR_01213 Vibrio campbellii (strain ATCC BAA-1116)
Q7MN15 4.48e-47 147 78 0 85 3 VV0902 UPF0250 protein VV0902 Vibrio vulnificus (strain YJ016)
Q8DFD3 4.48e-47 147 78 0 85 3 VV1_0282 UPF0250 protein VV1_0282 Vibrio vulnificus (strain CMCP6)
Q87RQ9 5.77e-47 147 80 0 85 3 VP0718 UPF0250 protein VP0718 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C6DBV8 1.31e-44 141 85 0 87 3 PC1_1177 UPF0250 protein PC1_1177 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A7MK40 2.27e-44 140 86 0 87 3 ESA_02696 UPF0250 protein ESA_02696 Cronobacter sakazakii (strain ATCC BAA-894)
Q6D7M6 2.77e-44 140 83 0 87 3 ECA1299 UPF0250 protein ECA1299 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q5QYE7 1.82e-34 115 60 0 86 3 IL0958 UPF0250 protein IL0958 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q89A91 8.65e-33 111 56 0 86 3 bbp_432 UPF0250 protein bbp_432 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q057D5 1.44e-32 111 52 0 87 3 BCc_307 UPF0250 protein BCc_307 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q8K978 3.03e-32 110 62 0 87 3 BUsg_472 UPF0250 protein BUsg_472 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A0KTV6 1.11e-31 108 55 0 87 3 Shewana3_0990 UPF0250 protein Shewana3_0990 Shewanella sp. (strain ANA-3)
Q0HLK1 1.11e-31 108 55 0 87 3 Shewmr4_0986 UPF0250 protein Shewmr4_0986 Shewanella sp. (strain MR-4)
Q0HXV5 1.11e-31 108 55 0 87 3 Shewmr7_1051 UPF0250 protein Shewmr7_1051 Shewanella sp. (strain MR-7)
A8FZ21 2.4e-31 108 55 0 87 3 Ssed_3490 UPF0250 protein Ssed_3490 Shewanella sediminis (strain HAW-EB3)
Q8EHQ4 3.72e-31 107 54 0 87 3 SO_1163 UPF0250 protein SO_1163 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A9L012 3.15e-30 105 51 0 87 3 Sbal195_3458 UPF0250 protein Sbal195_3458 Shewanella baltica (strain OS195)
A6WRL0 3.15e-30 105 51 0 87 3 Shew185_3322 UPF0250 protein Shew185_3322 Shewanella baltica (strain OS185)
A3D7P7 3.15e-30 105 51 0 87 3 Sbal_3280 UPF0250 protein Sbal_3280 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E4W6 3.15e-30 105 51 0 87 3 Sbal223_1087 UPF0250 protein Sbal223_1087 Shewanella baltica (strain OS223)
A4Y9G0 5.28e-30 104 50 0 87 3 Sputcn32_2874 UPF0250 protein Sputcn32_2874 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A1RGT4 5.28e-30 104 50 0 87 3 Sputw3181_1029 UPF0250 protein Sputw3181_1029 Shewanella sp. (strain W3-18-1)
P57559 6.53e-30 104 60 0 87 3 BU488 UPF0250 protein BU488 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D816 6.53e-30 104 60 0 87 3 BUAPTUC7_482 UPF0250 protein BUAPTUC7_482 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
B8D9R4 6.53e-30 104 60 0 87 3 BUAP5A_481 UPF0250 protein BUAP5A_481 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B1KDX1 5.51e-29 102 52 0 87 3 Swoo_3713 UPF0250 protein Swoo_3713 Shewanella woodyi (strain ATCC 51908 / MS32)
B8CSH5 2.03e-28 100 54 0 87 3 swp_3927 UPF0250 protein swp_3927 Shewanella piezotolerans (strain WP3 / JCM 13877)
A3QH58 1.9e-27 98 50 0 87 3 Shew_2940 UPF0250 protein Shew_2940 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q7VKA8 2.03e-27 98 54 0 86 3 HD_2015 UPF0250 protein HD_2015 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9CJR4 5.55e-27 97 56 0 86 3 PM1928 UPF0250 protein PM1928 Pasteurella multocida (strain Pm70)
A1S8T9 1.29e-26 96 49 0 87 3 Sama_2593 UPF0250 protein Sama_2593 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A8H7D3 7.36e-26 94 49 0 87 3 Spea_3154 UPF0250 protein Spea_3154 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TR55 2.23e-25 93 50 0 87 3 Shal_3239 UPF0250 protein Shal_3239 Shewanella halifaxensis (strain HAW-EB4)
Q3IJ79 1.56e-24 90 50 0 85 3 PSHAa1021 UPF0250 protein PSHAa1021 Pseudoalteromonas translucida (strain TAC 125)
A5UBB0 2.7e-24 90 49 0 85 3 CGSHiEE_03170 UPF0250 protein CGSHiEE_03170 Haemophilus influenzae (strain PittEE)
A5UFK0 2.7e-24 90 49 0 85 3 CGSHiGG_02625 UPF0250 protein CGSHiGG_02625 Haemophilus influenzae (strain PittGG)
Q4QPL6 2.7e-24 90 49 0 85 3 NTHI0035 UPF0250 protein NTHI0035 Haemophilus influenzae (strain 86-028NP)
P44465 2.7e-24 90 49 0 85 1 HI_0028 UPF0250 protein HI_0028 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q087L3 1.22e-22 86 47 0 87 3 Sfri_0694 UPF0250 protein Sfri_0694 Shewanella frigidimarina (strain NCIMB 400)
Q5F8I2 7.74e-16 68 41 1 82 3 NGO0791 UPF0250 protein NGO0791 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B4RLL1 1.83e-15 68 40 1 82 3 NGK_1021 UPF0250 protein NGK_1021 Neisseria gonorrhoeae (strain NCCP11945)
P67535 2e-15 67 40 1 82 3 NMA1380 UPF0250 protein NMA1380 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P67536 2e-15 67 40 1 82 3 NMB1218 UPF0250 protein NMB1218 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A1KU22 7.65e-15 66 39 1 82 3 NMC1112 UPF0250 protein NMC1112 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q7NTG1 8.09e-14 63 35 1 89 3 CV_3095 UPF0250 protein CV_3095 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
B2SWY1 2.4e-13 62 38 3 89 3 Bphyt_0500 UPF0250 protein Bphyt_0500 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
B1XYQ4 4.65e-13 62 36 1 84 3 Lcho_4239 UPF0250 protein Lcho_4239 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
B2JC42 6.99e-13 61 38 3 89 3 Bphy_0213 UPF0250 protein Bphy_0213 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
B7V8B5 1e-12 61 45 3 82 3 PLES_09781 UPF0250 protein PLES_09781 Pseudomonas aeruginosa (strain LESB58)
Q9X6V8 1e-12 61 45 3 82 3 PA3998 UPF0250 protein PA3998 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02SG5 1e-12 61 45 3 82 3 PA14_12110 UPF0250 protein PA14_12110 Pseudomonas aeruginosa (strain UCBPP-PA14)
A6T343 1.43e-12 60 39 1 82 3 mma_3250 UPF0250 protein mma_3250 Janthinobacterium sp. (strain Marseille)
A6V0B2 2.87e-12 60 42 2 82 3 PSPA7_1111 UPF0250 protein PSPA7_1111 Pseudomonas aeruginosa (strain PA7)
C1DMQ9 3.72e-12 59 42 2 82 3 Avin_08440 UPF0250 protein Avin_08440 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A4XYX5 5.16e-12 59 43 3 83 3 Pmen_3793 UPF0250 protein Pmen_3793 Pseudomonas mendocina (strain ymp)
Q82UJ7 6e-12 58 35 1 82 3 NE1487 UPF0250 protein NE1487 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q7W0L0 7.53e-12 58 37 2 83 3 BP0104 UPF0250 protein BP0104 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q8Y2K9 1.01e-11 58 35 1 82 3 RSc0326 UPF0250 protein RSc0326 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q7WR02 4.02e-11 57 36 2 83 3 BB0170 UPF0250 protein BB0170 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7W224 4.02e-11 57 36 2 83 3 BPP0168 UPF0250 protein BPP0168 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
A5CWR4 5.14e-08 48 32 2 84 3 COSY_0496 UPF0250 protein COSY_0496 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q2SA36 5.73e-08 48 33 1 81 3 HCH_05838 UPF0250 protein HCH_05838 Hahella chejuensis (strain KCTC 2396)
A1AWI6 1.83e-06 45 33 2 84 3 Rmag_0541 UPF0250 protein Rmag_0541 Ruthia magnifica subsp. Calyptogena magnifica
Q87VW5 1.03e-05 43 34 2 81 3 PSPTO_4820 UPF0250 protein PSPTO_4820 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4ZN82 1.83e-05 42 34 2 81 3 Psyr_4360 UPF0250 protein Psyr_4360 Pseudomonas syringae pv. syringae (strain B728a)
B1J142 9.98e-05 40 33 2 81 3 PputW619_0619 UPF0250 protein PputW619_0619 Pseudomonas putida (strain W619)
Q88DM3 0.000144 40 33 2 81 3 PP_4802 UPF0250 protein PP_4802 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q1I4F9 0.000218 39 32 2 81 3 PSEEN4821 UPF0250 protein PSEEN4821 Pseudomonas entomophila (strain L48)
B0KJX6 0.000251 39 32 2 81 3 PputGB1_4855 UPF0250 protein PputGB1_4855 Pseudomonas putida (strain GB-1)
A5W9I7 0.000251 39 32 2 81 3 Pput_4677 UPF0250 protein Pput_4677 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS02080
Feature type CDS
Gene ybeD
Product DUF493 family protein YbeD
Location 489467 - 489730 (strand: -1)
Length 264 (nucleotides) / 87 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1559
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04359 Protein of unknown function (DUF493)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2921 Signal transduction mechanisms (T) T Putative lipoate-binding regulatory protein, UPF0250 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09158 uncharacterized protein - -

Protein Sequence

MKTKLNELLEFPCSFTYKVMGHAKPELVDQVVEVIQRHAPGDYTPSVKPSSKGNYHSVSVTINATHIEQVETLYKELGELELVRMVL

Flanking regions ( +/- flanking 50bp)

AAAGAGATTATTAAAACAACATCGCCTGTTGTCTTAAGGATTACATTATGATGAAAACAAAATTAAACGAACTATTAGAGTTCCCTTGCTCATTTACTTACAAAGTCATGGGTCATGCTAAACCCGAATTAGTTGACCAAGTCGTTGAAGTGATCCAGCGTCATGCACCCGGTGATTATACACCTTCAGTAAAACCAAGTAGCAAAGGTAACTATCACTCAGTCTCGGTGACTATCAACGCAACGCATATTGAACAAGTAGAAACCCTCTATAAAGAGTTAGGTGAATTAGAGCTTGTTCGCATGGTGTTATAATTTTTTTCTATTTGCCCCCTTACCCTATTAGGGGGCATTAGACGTACTTA