Homologs in group_2239

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17145 FBDBKF_17145 30.8 Morganella morganii S1 pncA Nicotinamidase-related amidase
EHELCC_01745 EHELCC_01745 30.8 Morganella morganii S2 pncA Nicotinamidase-related amidase
NLDBIP_01715 NLDBIP_01715 30.8 Morganella morganii S4 pncA Nicotinamidase-related amidase
LHKJJB_00320 LHKJJB_00320 30.8 Morganella morganii S3 pncA Nicotinamidase-related amidase
HKOGLL_00360 HKOGLL_00360 30.8 Morganella morganii S5 pncA Nicotinamidase-related amidase
F4V73_RS08900 F4V73_RS08900 24.0 Morganella psychrotolerans - cysteine hydrolase family protein

Distribution of the homologs in the orthogroup group_2239

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2239

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ADI7 3.46e-18 81 31 2 182 1 yecD Isochorismatase family protein YecD Escherichia coli (strain K12)
P0ADI8 3.46e-18 81 31 2 182 3 yecD Uncharacterized isochorismatase family protein YecD Escherichia coli O157:H7
Q1M7F4 2.77e-16 77 28 5 199 1 biuH Biuret amidohydrolase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P74965 3.85e-15 75 29 5 191 3 venB Probable isochorismatase Vibrio vulnificus (strain CMCP6)
Q88FY5 2.07e-13 69 22 2 167 1 nicF Maleamate amidohydrolase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P94573 5.46e-13 67 28 6 184 3 ywoC Uncharacterized isochorismatase family protein YwoC Bacillus subtilis (strain 168)
P32400 1.71e-12 67 31 1 133 1 None N-carbamoylsarcosine amidase Arthrobacter sp.
P96654 1.8e-12 66 27 4 158 3 yddQ Uncharacterized isochorismatase family protein YddQ Bacillus subtilis (strain 168)
A1JMX8 3.37e-12 66 29 4 177 3 rutB Ureidoacrylate amidohydrolase RutB Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P75897 1.24e-11 64 28 3 172 1 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli (strain K12)
B1X9D2 1.24e-11 64 28 3 172 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli (strain K12 / DH10B)
C9QZ65 1.24e-11 64 28 3 172 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli (strain ATCC 33849 / DSM 4235 / NCIMB 12045 / K12 / DH1)
C4ZQD9 1.24e-11 64 28 3 172 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli (strain K12 / MC4100 / BW2952)
C6UFC2 1.43e-11 64 28 3 172 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli (strain B / REL606)
C6EHJ6 1.43e-11 64 28 3 172 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli (strain B / BL21-DE3)
B7N3G7 1.55e-11 64 28 3 172 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
D3H124 1.55e-11 64 28 3 172 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O44:H18 (strain 042 / EAEC)
B1IV86 1.56e-11 64 28 3 172 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZYW6 1.56e-11 64 28 3 172 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O9:H4 (strain HS)
D2NGI8 1.58e-11 64 28 3 172 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O150:H5 (strain SE15)
B7M8Z6 1.58e-11 64 28 3 172 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O8 (strain IAI1)
B7LFC1 1.58e-11 64 28 3 172 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli (strain 55989 / EAEC)
C8TNC1 1.58e-11 64 28 3 172 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O26:H11 (strain 11368 / EHEC)
C8UMM7 1.58e-11 64 28 3 172 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O111:H- (strain 11128 / EHEC)
A7ZKB6 1.63e-11 64 28 3 172 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O139:H28 (strain E24377A / ETEC)
Q3Z3A3 2.05e-11 64 28 3 172 3 rutB Ureidoacrylate amidohydrolase RutB Shigella sonnei (strain Ss046)
D3QPK4 2.18e-11 64 28 3 172 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O55:H7 (strain CB9615 / EPEC)
P58760 2.99e-11 63 27 4 169 3 rutB Ureidoacrylate amidohydrolase RutB Agrobacterium fabrum (strain C58 / ATCC 33970)
B7MTF4 3.98e-11 63 27 3 172 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O81 (strain ED1a)
Q0TJ56 4.36e-11 63 27 4 173 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7UNZ4 4.72e-11 63 27 3 172 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B6I987 7.8e-11 62 27 4 173 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli (strain SE11)
C8U5H3 7.8e-11 62 27 4 173 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O103:H2 (strain 12009 / EHEC)
Q97TR7 9.55e-11 61 24 3 186 3 CA_P0030 Uncharacterized isochorismatase family protein CA_P0030 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B9JLT8 1.32e-10 62 27 4 169 3 rutB Ureidoacrylate amidohydrolase RutB Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
B1LIZ4 1.64e-10 61 27 4 172 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli (strain SMS-3-5 / SECEC)
B7NLB5 1.72e-10 61 27 4 172 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YU52 1.88e-10 61 27 3 172 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q6FFZ6 1.97e-10 61 26 5 177 3 rutB Ureidoacrylate amidohydrolase RutB Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
C6UPN3 2.04e-10 61 27 3 172 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O157:H7 (strain TW14359 / EHEC)
Q8XAU3 2.04e-10 61 27 3 172 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O157:H7
Q0T623 2.54e-10 61 28 2 139 3 rutB Ureidoacrylate amidohydrolase RutB Shigella flexneri serotype 5b (strain 8401)
A4VQH5 2.76e-10 61 25 3 170 3 rutB Ureidoacrylate amidohydrolase RutB Stutzerimonas stutzeri (strain A1501)
D5CZH1 3.13e-10 60 26 3 172 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O18:K1:H7 (strain IHE3034 / ExPEC)
P0C6D3 3.26e-10 61 27 4 191 1 vibB Vibriobactin-specific isochorismatase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F3F4 3.26e-10 61 27 4 191 3 vibB Vibriobactin-specific isochorismatase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P0ADI6 3.27e-10 61 24 4 185 3 entB Enterobactin synthase component B Shigella flexneri
P0ADI4 3.27e-10 61 24 4 185 1 entB Enterobactin synthase component B Escherichia coli (strain K12)
P0ADI5 3.27e-10 61 24 4 185 3 entB Enterobactin synthase component B Escherichia coli O157:H7
B7MIF8 3.36e-10 60 26 3 172 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O45:K1 (strain S88 / ExPEC)
Q83RV3 3.44e-10 60 28 2 139 3 rutB Ureidoacrylate amidohydrolase RutB Shigella flexneri
D2AC42 3.44e-10 60 28 2 139 3 rutB Ureidoacrylate amidohydrolase RutB Shigella flexneri serotype X (strain 2002017)
A0A2N6JFX7 3.93e-10 60 25 7 207 1 trtA Triuret hydrolase TrtA Herbaspirillum sp. (strain BH-1)
Q1RDK6 4.45e-10 60 26 3 172 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli (strain UTI89 / UPEC)
A1A9R6 4.45e-10 60 26 3 172 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O1:K1 / APEC
G2X4M1 6.61e-10 59 25 1 158 1 Isc1 Secreted isochorismatase effector Isc1 Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137)
A8GCT5 6.86e-10 60 27 3 172 3 rutB Ureidoacrylate amidohydrolase RutB Serratia proteamaculans (strain 568)
Q8FJ42 1.22e-09 59 26 4 173 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A8IAC9 1.55e-09 58 25 3 150 3 rutB Ureidoacrylate amidohydrolase RutB Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q93Z51 1.21e-08 55 27 4 170 2 At3g16190 Probable inactive nicotinamidase At3g16190 Arabidopsis thaliana
D0LI56 1.33e-08 56 26 2 142 3 rutB Ureidoacrylate amidohydrolase RutB Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2)
Q9A4N5 1.94e-08 55 26 3 149 3 rutB Ureidoacrylate amidohydrolase RutB Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q51790 2.75e-08 55 26 7 187 1 phzD Phenazine biosynthesis protein PhzD Pseudomonas fluorescens
B8H1Q1 3.35e-08 55 26 3 149 3 rutB Ureidoacrylate amidohydrolase RutB Caulobacter vibrioides (strain NA1000 / CB15N)
Q48MQ5 7.78e-08 54 28 6 179 3 rutB Ureidoacrylate amidohydrolase RutB Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q51518 1.09e-07 53 26 7 187 3 phzA Probable isochorismatase Pseudomonas chlororaphis
Q4ZXR8 1.77e-07 53 27 5 172 3 rutB Ureidoacrylate amidohydrolase RutB Pseudomonas syringae pv. syringae (strain B728a)
P0DPC1 2.37e-07 52 25 6 183 1 phzD2 Phenazine biosynthesis protein PhzD2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0DPB9 2.37e-07 52 25 6 183 1 phzD1 Phenazine biosynthesis protein PhzD1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A6T7A1 4.57e-07 52 35 0 68 3 rutB Ureidoacrylate amidohydrolase RutB Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
D3RKL1 4.62e-07 52 35 0 68 3 rutB Ureidoacrylate amidohydrolase RutB Klebsiella variicola (strain At-22)
B5XXN1 4.89e-07 52 35 0 68 3 rutB Ureidoacrylate amidohydrolase RutB Klebsiella pneumoniae (strain 342)
B0SW60 1.19e-06 50 26 3 149 3 rutB Ureidoacrylate amidohydrolase RutB Caulobacter sp. (strain K31)
A4W924 1.67e-06 50 27 4 173 3 rutB Ureidoacrylate amidohydrolase RutB Enterobacter sp. (strain 638)
D5VGV1 1.84e-06 50 25 2 142 3 rutB Ureidoacrylate amidohydrolase RutB Caulobacter segnis (strain ATCC 21756 / DSM 7131 / JCM 7823 / NBRC 15250 / LMG 17158 / TK0059)
B1ZB16 3.08e-06 49 30 0 80 3 rutB Ureidoacrylate amidohydrolase RutB Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
B1M6B8 3.29e-06 49 25 3 126 3 rutB Ureidoacrylate amidohydrolase RutB Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
C5B0U8 3.31e-06 49 28 0 80 3 rutB Ureidoacrylate amidohydrolase RutB Methylorubrum extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)
A9W3I0 3.51e-06 49 28 0 80 3 rutB Ureidoacrylate amidohydrolase RutB Methylorubrum extorquens (strain PA1)
C7CM35 3.51e-06 49 28 0 80 3 rutB Ureidoacrylate amidohydrolase RutB Methylorubrum extorquens (strain DSM 6343 / CIP 106787 / DM4)
B7KWT6 4.09e-06 49 28 0 80 3 rutB Ureidoacrylate amidohydrolase RutB Methylorubrum extorquens (strain CM4 / NCIMB 13688)
D5CE33 4.26e-06 49 27 3 170 3 rutB Ureidoacrylate amidohydrolase RutB Enterobacter cloacae subsp. cloacae (strain ATCC 13047 / DSM 30054 / NBRC 13535 / NCTC 10005 / WDCM 00083 / NCDC 279-56)
D4GEU5 4.55e-06 49 35 0 68 3 rutB Ureidoacrylate amidohydrolase RutB Pantoea ananatis (strain LMG 20103)
P37532 8.82e-06 47 24 5 190 3 yaaI Uncharacterized isochorismatase family protein YaaI Bacillus subtilis (strain 168)
C5CN80 1.58e-05 47 34 0 67 3 rutB Ureidoacrylate amidohydrolase RutB Variovorax paradoxus (strain S110)
D4GWH7 1.88e-05 47 25 1 131 1 HVO_2328 Uncharacterized isochorismatase family protein HVO_2328 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
O07081 3.31e-05 46 21 1 157 3 yrdC Uncharacterized isochorismatase family protein YrdC Bacillus subtilis (strain 168)
O32091 4.74e-05 45 28 1 98 3 pncA Uncharacterized isochorismatase family protein PncA Bacillus subtilis (strain 168)
Q1MW86 0.000241 44 23 3 159 1 sttH Streptothricin hydrolase Streptomyces noursei
C5NU54 0.000291 43 23 3 159 1 sttH Streptothricin hydrolase Streptomyces noursei
Q9FMX7 0.00051 42 26 6 168 1 NIC2 Nicotinamidase 2 Arabidopsis thaliana

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS02000
Feature type CDS
Gene -
Product isochorismatase family cysteine hydrolase
Location 471566 - 472168 (strand: 1)
Length 603 (nucleotides) / 200 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2239
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00857 Isochorismatase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1335 Coenzyme transport and metabolism (H)
General function prediction only (R)		 HR Nicotinamidase-related amidase

Protein Sequence

MTTQFNNNNNNIDKNSALLVMDFQTTILNNFLPQDRAEDVIRNTSSLISATRAAGIPIIYVSVEFREGYPEVSQNNIIFSSIKDNGILITNSESSAIHDDIFPQENEIVIIKRRVGAFSFTELEMVLRTQGIETLILAGVTTSGVILSTVSQAFDLDYRLVIVSDCCADPDHDTHVFLLEKILSQHAVVTSSSEISKYWV

Flanking regions ( +/- flanking 50bp)

TATACGCTGATGAACTTCGTTCTTCTTCACCTGTATATTTCGGAGATTTTATGACAACACAATTCAACAATAACAATAATAATATCGATAAAAATAGTGCTCTGCTGGTAATGGATTTTCAGACGACCATTCTTAATAATTTTCTTCCACAAGATCGTGCTGAAGATGTTATTCGTAATACATCATCATTAATTTCCGCTACGCGTGCAGCAGGCATACCGATTATCTATGTTAGTGTTGAGTTTCGTGAGGGGTATCCTGAGGTTAGTCAAAACAATATAATTTTCTCATCGATTAAAGACAATGGAATATTAATCACCAATAGTGAAAGTTCCGCTATTCATGATGATATTTTTCCGCAGGAAAATGAAATCGTTATTATTAAACGTAGAGTGGGGGCTTTTTCATTTACTGAGCTTGAGATGGTTCTTCGTACACAAGGTATTGAAACCTTGATCCTTGCAGGAGTCACGACCAGTGGCGTGATTTTATCTACAGTTAGTCAGGCATTTGACCTAGATTATCGTCTAGTGATTGTAAGTGATTGTTGTGCCGATCCTGATCATGACACACATGTTTTTTTACTCGAGAAAATCTTGTCTCAACATGCTGTTGTAACCAGTTCATCTGAAATATCAAAATATTGGGTATAAATAGACTAAGTAGCCAATGTTACATAGATCTTGTCGGTAGTATGATAGAT