Homologs in group_2239

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17145 FBDBKF_17145 37.6 Morganella morganii S1 pncA Nicotinamidase-related amidase
EHELCC_01745 EHELCC_01745 37.6 Morganella morganii S2 pncA Nicotinamidase-related amidase
NLDBIP_01715 NLDBIP_01715 37.6 Morganella morganii S4 pncA Nicotinamidase-related amidase
LHKJJB_00320 LHKJJB_00320 37.6 Morganella morganii S3 pncA Nicotinamidase-related amidase
HKOGLL_00360 HKOGLL_00360 37.6 Morganella morganii S5 pncA Nicotinamidase-related amidase
PMI_RS02000 PMI_RS02000 24.0 Proteus mirabilis HI4320 - isochorismatase family cysteine hydrolase

Distribution of the homologs in the orthogroup group_2239

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2239

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P96654 1.29e-17 79 32 3 140 3 yddQ Uncharacterized isochorismatase family protein YddQ Bacillus subtilis (strain 168)
G2X4M1 1.02e-15 74 28 2 168 1 Isc1 Secreted isochorismatase effector Isc1 Verticillium dahliae (strain VdLs.17 / ATCC MYA-4575 / FGSC 10137)
Q9FMX7 4.32e-15 72 34 6 155 1 NIC2 Nicotinamidase 2 Arabidopsis thaliana
P0ADI7 2.67e-14 70 29 2 154 1 yecD Isochorismatase family protein YecD Escherichia coli (strain K12)
P0ADI8 2.67e-14 70 29 2 154 3 yecD Uncharacterized isochorismatase family protein YecD Escherichia coli O157:H7
Q9FMX8 5.27e-14 70 33 6 155 1 NIC3 Nicotinamidase 3 Arabidopsis thaliana
A0A1B2CTB8 5.77e-14 70 33 4 138 1 penJ Epoxide hydrolase penJ Penicillium thymicola
O07081 1.59e-13 68 29 3 163 3 yrdC Uncharacterized isochorismatase family protein YrdC Bacillus subtilis (strain 168)
D4GWH7 1.79e-12 65 33 5 163 1 HVO_2328 Uncharacterized isochorismatase family protein HVO_2328 Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
P94573 4.52e-12 64 29 6 164 3 ywoC Uncharacterized isochorismatase family protein YwoC Bacillus subtilis (strain 168)
Q1MW86 1.51e-11 64 31 4 176 1 sttH Streptothricin hydrolase Streptomyces noursei
Q97TR7 2.03e-11 62 26 3 158 3 CA_P0030 Uncharacterized isochorismatase family protein CA_P0030 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
C5NU54 4.29e-09 57 33 3 143 1 sttH Streptothricin hydrolase Streptomyces noursei
Q93Z51 4.23e-08 53 27 7 190 2 At3g16190 Probable inactive nicotinamidase At3g16190 Arabidopsis thaliana
A0A2N6JFX7 1.13e-07 53 26 5 168 1 trtA Triuret hydrolase TrtA Herbaspirillum sp. (strain BH-1)
Q1M7F4 2.3e-05 46 27 2 102 1 biuH Biuret amidohydrolase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
P21367 3.7e-05 45 28 5 145 1 ycaC Probable hydrolase YcaC Escherichia coli (strain K12)
Q88FY5 4.47e-05 45 28 5 152 1 nicF Maleamate amidohydrolase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
C5CN80 0.000155 44 36 1 72 3 rutB Ureidoacrylate amidohydrolase RutB Variovorax paradoxus (strain S110)
P0ADI6 0.000174 44 25 5 166 3 entB Enterobactin synthase component B Shigella flexneri
P0ADI4 0.000174 44 25 5 166 1 entB Enterobactin synthase component B Escherichia coli (strain K12)
P0ADI5 0.000174 44 25 5 166 3 entB Enterobactin synthase component B Escherichia coli O157:H7
B5XXN1 0.000249 43 36 1 72 3 rutB Ureidoacrylate amidohydrolase RutB Klebsiella pneumoniae (strain 342)
A6T7A1 0.000258 43 36 1 72 3 rutB Ureidoacrylate amidohydrolase RutB Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
D3RKL1 0.000261 43 36 1 72 3 rutB Ureidoacrylate amidohydrolase RutB Klebsiella variicola (strain At-22)
P53184 0.000469 42 33 1 60 1 PNC1 Nicotinamidase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
A4W924 0.000594 42 34 1 72 3 rutB Ureidoacrylate amidohydrolase RutB Enterobacter sp. (strain 638)
B7NLB5 0.000647 42 36 1 72 3 rutB Ureidoacrylate amidohydrolase RutB Escherichia coli O7:K1 (strain IAI39 / ExPEC)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS08900
Feature type CDS
Gene -
Product cysteine hydrolase family protein
Location 1847309 - 1847848 (strand: 1)
Length 540 (nucleotides) / 179 (amino acids)

Contig

Accession term accessions NZ_VXKB01000001 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 2012992 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2239
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00857 Isochorismatase family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1335 Coenzyme transport and metabolism (H)
General function prediction only (R)		 HR Nicotinamidase-related amidase

Protein Sequence

MLLSKHALLIIDMQQGLFHGPVSPYSATQVLSNICLLIEKARQAQVPVFFARHTGPDDSPFSEQSPLTQLIREMNVNAERDIVFVKKYPSCFRDTDLQRQLSQRGVKELVIAGMKTEFCVDTTCRAAPELGFRTMLISDAHTTMDNEHLSASEIIGHHNVTLAGPFVALATAADWSFSF

Flanking regions ( +/- flanking 50bp)

AACGGGGAAGAAAATCTCTCCGTTCATAACACTCTGAATGGAGACACATCATGCTTTTATCTAAACATGCACTTTTAATTATCGATATGCAGCAAGGGCTTTTTCATGGCCCGGTTTCCCCATATTCCGCAACCCAGGTTCTGTCAAATATTTGTCTGCTGATTGAAAAAGCCCGACAGGCTCAGGTACCTGTTTTTTTTGCCCGACACACAGGCCCCGACGATTCCCCTTTCTCAGAGCAAAGTCCGCTAACACAACTGATACGCGAAATGAACGTTAACGCTGAGCGGGATATCGTGTTCGTTAAAAAGTACCCCAGCTGTTTCCGGGATACCGATCTGCAGCGTCAGCTTAGCCAGAGAGGCGTTAAAGAGCTGGTTATTGCCGGTATGAAAACAGAATTCTGTGTGGATACTACCTGCCGCGCAGCACCGGAACTGGGATTCAGGACGATGCTGATTTCAGATGCGCATACAACAATGGATAACGAACATTTGTCAGCGAGTGAAATCATCGGTCATCACAACGTTACGCTGGCCGGACCGTTTGTGGCTCTCGCAACCGCAGCTGACTGGAGTTTTTCATTCTGAGAAATGAGTCTGAATACAGAGCCGCCTCATGGCGGCTAAAATGTTCAACG