Homologs in group_2048

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15350 FBDBKF_15350 73.9 Morganella morganii S1 raiA ribosome-associated translation inhibitor RaiA
EHELCC_10895 EHELCC_10895 73.9 Morganella morganii S2 raiA ribosome-associated translation inhibitor RaiA
NLDBIP_11240 NLDBIP_11240 73.9 Morganella morganii S4 raiA ribosome-associated translation inhibitor RaiA
LHKJJB_11100 LHKJJB_11100 73.9 Morganella morganii S3 raiA ribosome-associated translation inhibitor RaiA
HKOGLL_09710 HKOGLL_09710 73.9 Morganella morganii S5 raiA ribosome-associated translation inhibitor RaiA
F4V73_RS12105 F4V73_RS12105 71.2 Morganella psychrotolerans raiA ribosome-associated translation inhibitor RaiA

Distribution of the homologs in the orthogroup group_2048

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2048

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AD52 1.75e-49 155 65 0 107 3 yfiA Ribosome-associated factor Y Shigella flexneri
P0AD49 1.75e-49 155 65 0 107 1 raiA Ribosome-associated inhibitor A Escherichia coli (strain K12)
P0AD50 1.75e-49 155 65 0 107 3 yfiA Ribosome-associated factor Y Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AD51 1.75e-49 155 65 0 107 3 yfiA Ribosome-associated factor Y Escherichia coli O157:H7
P71346 2.6e-44 142 66 0 103 1 yfiA Ribosome-associated factor Y Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P17160 1.55e-16 72 35 1 104 3 hpf Ribosome hibernation promoting factor Azotobacter vinelandii
P0A148 8.79e-15 67 35 0 94 3 hpf Ribosome hibernation promoting factor Pseudomonas putida
P0A147 8.79e-15 67 35 0 94 3 hpf Ribosome hibernation promoting factor Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P0AFX3 9.13e-14 64 35 1 96 3 hpf Ribosome hibernation promoting factor Shigella flexneri
P0AFX0 9.13e-14 64 35 1 96 1 hpf Ribosome hibernation promoting factor Escherichia coli (strain K12)
P0AFX1 9.13e-14 64 35 1 96 3 hpf Ribosome hibernation promoting factor Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AFX2 9.13e-14 64 35 1 96 3 hpf Ribosome hibernation promoting factor Escherichia coli O157:H7
P17161 2.79e-13 63 35 1 96 3 hpf Ribosome hibernation promoting factor Klebsiella oxytoca
P26983 8.33e-13 62 35 1 93 3 hpf Ribosome hibernation promoting factor Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q9RVE7 8.41e-09 53 27 1 95 1 hpf Ribosome hibernation promotion factor Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
P28613 1.08e-08 52 30 2 91 3 hpf Ribosome hibernation promoting factor Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P33987 2.21e-08 51 36 2 97 3 hpf Ribosome hibernation promoting factor Acinetobacter guillouiae
P30334 1.54e-07 50 29 2 99 3 hpf Ribosome hibernation promotion factor Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A0A0H3GEZ8 7.36e-05 43 31 3 96 1 hpf Ribosome hibernation promotion factor Listeria monocytogenes serotype 1/2a (strain 10403S)
P28368 9.13e-05 42 29 2 99 1 yvyD Ribosome hibernation promotion factor Bacillus subtilis (strain 168)
Q8CTF2 0.00023 41 27 3 112 3 hpf Ribosome hibernation promotion factor Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQX7 0.00023 41 27 3 112 3 hpf Ribosome hibernation promotion factor Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4L4H7 0.00036 41 28 3 112 3 hpf Ribosome hibernation promotion factor Staphylococcus haemolyticus (strain JCSC1435)
A2RIX0 0.000682 40 25 3 115 1 hpf Ribosome hibernation promotion factor Lactococcus lactis subsp. cremoris (strain MG1363)
Q5XAQ7 0.000827 40 29 3 89 1 hpf Ribosome hibernation promotion factor Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS01900
Feature type CDS
Gene raiA
Product ribosome-associated translation inhibitor RaiA
Location 446485 - 446820 (strand: -1)
Length 336 (nucleotides) / 111 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2048
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02482 Sigma 54 modulation protein / S30EA ribosomal protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1544 Translation, ribosomal structure and biogenesis (J) J Ribosome-associated translation inhibitor RaiA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05809 ribosome-associated inhibitor A - -

Protein Sequence

MIINITSKQMDITPALREHIESRLTKLNKWQVNLINPHIILTKDPKGFSVDASIHTPNGQLVANAQHVDMYAAINDLLAKLERQLNKVQHKNESRRAANSLKEENLLVNEI

Flanking regions ( +/- flanking 50bp)

ATCACGATATTCTGAACCTATCCAAGATGGAGTAATAAAGAGGTAACTATATGATTATAAATATCACTAGCAAACAAATGGACATTACCCCAGCACTACGTGAACACATTGAAAGCCGTTTAACTAAACTTAACAAATGGCAGGTAAATTTAATCAACCCTCATATTATTCTCACTAAGGATCCAAAAGGTTTTAGTGTTGATGCAAGTATTCATACTCCGAATGGACAACTTGTAGCAAACGCACAACATGTTGATATGTATGCGGCAATTAATGATCTCTTGGCAAAATTGGAACGTCAATTAAATAAAGTTCAGCATAAAAATGAGTCTCGACGTGCGGCCAATAGCTTAAAAGAAGAAAATTTACTCGTAAATGAAATATAAGTAGTGAAGCTTGATTAAAAATTAGAATAATTCACTGACTCAAAACGCCT