Homologs in group_2041

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15305 FBDBKF_15305 82.9 Morganella morganii S1 rpsP 30S ribosomal protein S16
EHELCC_10940 EHELCC_10940 82.9 Morganella morganii S2 rpsP 30S ribosomal protein S16
NLDBIP_11285 NLDBIP_11285 82.9 Morganella morganii S4 rpsP 30S ribosomal protein S16
LHKJJB_11145 LHKJJB_11145 82.9 Morganella morganii S3 rpsP 30S ribosomal protein S16
HKOGLL_09755 HKOGLL_09755 82.9 Morganella morganii S5 rpsP 30S ribosomal protein S16
F4V73_RS12145 F4V73_RS12145 84.1 Morganella psychrotolerans rpsP 30S ribosomal protein S16

Distribution of the homologs in the orthogroup group_2041

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2041

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EUW4 6.69e-55 167 100 0 82 3 rpsP Small ribosomal subunit protein bS16 Proteus mirabilis (strain HI4320)
Q2NVK4 7.91e-48 149 84 0 82 3 rpsP Small ribosomal subunit protein bS16 Sodalis glossinidius (strain morsitans)
C5BGG2 2.5e-47 147 85 0 82 3 rpsP Small ribosomal subunit protein bS16 Edwardsiella ictaluri (strain 93-146)
Q6D1T8 2.51e-46 145 82 0 82 3 rpsP Small ribosomal subunit protein bS16 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A8GA18 1.04e-45 144 82 0 82 3 rpsP Small ribosomal subunit protein bS16 Serratia proteamaculans (strain 568)
B1JJ91 1.59e-45 143 81 0 82 3 rpsP Small ribosomal subunit protein bS16 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66E59 1.59e-45 143 81 0 82 3 rpsP Small ribosomal subunit protein bS16 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TQ62 1.59e-45 143 81 0 82 3 rpsP Small ribosomal subunit protein bS16 Yersinia pestis (strain Pestoides F)
Q1CLJ5 1.59e-45 143 81 0 82 3 rpsP Small ribosomal subunit protein bS16 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R0U5 1.59e-45 143 81 0 82 3 rpsP Small ribosomal subunit protein bS16 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZBU7 1.59e-45 143 81 0 82 3 rpsP Small ribosomal subunit protein bS16 Yersinia pestis
B2K5Y8 1.59e-45 143 81 0 82 3 rpsP Small ribosomal subunit protein bS16 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C411 1.59e-45 143 81 0 82 3 rpsP Small ribosomal subunit protein bS16 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FLQ7 1.59e-45 143 81 0 82 3 rpsP Small ribosomal subunit protein bS16 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
C6DCQ1 1.61e-45 143 81 0 82 3 rpsP Small ribosomal subunit protein bS16 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A1JK22 2.75e-45 142 81 0 82 3 rpsP Small ribosomal subunit protein bS16 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B2VHI6 7.98e-45 141 80 0 82 3 rpsP Small ribosomal subunit protein bS16 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q7N7A0 2.82e-44 140 80 0 82 3 rpsP Small ribosomal subunit protein bS16 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A6TCL7 3.23e-43 137 79 0 82 3 rpsP Small ribosomal subunit protein bS16 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q07Z05 9.85e-43 136 80 0 81 3 rpsP Small ribosomal subunit protein bS16 Shewanella frigidimarina (strain NCIMB 400)
A1S3Z0 1.37e-42 136 76 0 82 3 rpsP Small ribosomal subunit protein bS16 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B5XVK3 2.6e-42 135 78 0 82 3 rpsP Small ribosomal subunit protein bS16 Klebsiella pneumoniae (strain 342)
A0KG23 2.6e-42 135 78 0 82 3 rpsP Small ribosomal subunit protein bS16 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q12KJ3 3.15e-42 135 79 0 81 3 rpsP Small ribosomal subunit protein bS16 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B1KI68 3.44e-42 135 78 0 82 3 rpsP Small ribosomal subunit protein bS16 Shewanella woodyi (strain ATCC 51908 / MS32)
Q47WU8 3.96e-42 134 79 0 78 3 rpsP Small ribosomal subunit protein bS16 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
P44382 4.65e-42 134 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UG06 4.65e-42 134 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Haemophilus influenzae (strain PittGG)
A5UAV1 4.65e-42 134 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Haemophilus influenzae (strain PittEE)
Q4QNY6 4.65e-42 134 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Haemophilus influenzae (strain 86-028NP)
A8H1D9 8.11e-42 134 76 0 82 3 rpsP Small ribosomal subunit protein bS16 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TJ75 8.11e-42 134 76 0 82 3 rpsP Small ribosomal subunit protein bS16 Shewanella halifaxensis (strain HAW-EB4)
A4WDH4 9.59e-42 134 79 0 82 3 rpsP Small ribosomal subunit protein bS16 Enterobacter sp. (strain 638)
P58123 1.11e-41 133 74 0 82 3 rpsP Small ribosomal subunit protein bS16 Pasteurella multocida (strain Pm70)
B0V8L2 2.11e-41 133 76 0 81 3 rpsP Small ribosomal subunit protein bS16 Acinetobacter baumannii (strain AYE)
A3M9G7 2.11e-41 133 76 0 81 3 rpsP Small ribosomal subunit protein bS16 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VQ56 2.11e-41 133 76 0 81 3 rpsP Small ribosomal subunit protein bS16 Acinetobacter baumannii (strain SDF)
B2HZV5 2.11e-41 133 76 0 81 3 rpsP Small ribosomal subunit protein bS16 Acinetobacter baumannii (strain ACICU)
B7IAT2 2.11e-41 133 76 0 81 3 rpsP Small ribosomal subunit protein bS16 Acinetobacter baumannii (strain AB0057)
B7GVR8 2.11e-41 133 76 0 81 3 rpsP Small ribosomal subunit protein bS16 Acinetobacter baumannii (strain AB307-0294)
A3QBT6 2.57e-41 132 75 0 82 3 rpsP Small ribosomal subunit protein bS16 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A4SIV7 2.78e-41 132 76 0 82 3 rpsP Small ribosomal subunit protein bS16 Aeromonas salmonicida (strain A449)
A8FSE7 2.86e-41 132 76 0 82 3 rpsP Small ribosomal subunit protein bS16 Shewanella sediminis (strain HAW-EB3)
A8ANE2 3.91e-41 132 75 0 82 3 rpsP Small ribosomal subunit protein bS16 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P0A2A9 4.82e-41 132 75 0 82 3 rpsP Small ribosomal subunit protein bS16 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2B0 4.82e-41 132 75 0 82 3 rpsP Small ribosomal subunit protein bS16 Salmonella typhi
B4TS56 4.82e-41 132 75 0 82 3 rpsP Small ribosomal subunit protein bS16 Salmonella schwarzengrund (strain CVM19633)
B5BE94 4.82e-41 132 75 0 82 3 rpsP Small ribosomal subunit protein bS16 Salmonella paratyphi A (strain AKU_12601)
C0PW19 4.82e-41 132 75 0 82 3 rpsP Small ribosomal subunit protein bS16 Salmonella paratyphi C (strain RKS4594)
A9MZ51 4.82e-41 132 75 0 82 3 rpsP Small ribosomal subunit protein bS16 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PFF6 4.82e-41 132 75 0 82 3 rpsP Small ribosomal subunit protein bS16 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T2B5 4.82e-41 132 75 0 82 3 rpsP Small ribosomal subunit protein bS16 Salmonella newport (strain SL254)
B4TE53 4.82e-41 132 75 0 82 3 rpsP Small ribosomal subunit protein bS16 Salmonella heidelberg (strain SL476)
B5RD85 4.82e-41 132 75 0 82 3 rpsP Small ribosomal subunit protein bS16 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QUG4 4.82e-41 132 75 0 82 3 rpsP Small ribosomal subunit protein bS16 Salmonella enteritidis PT4 (strain P125109)
B5FS09 4.82e-41 132 75 0 82 3 rpsP Small ribosomal subunit protein bS16 Salmonella dublin (strain CT_02021853)
Q57L29 4.82e-41 132 75 0 82 3 rpsP Small ribosomal subunit protein bS16 Salmonella choleraesuis (strain SC-B67)
B5F289 4.82e-41 132 75 0 82 3 rpsP Small ribosomal subunit protein bS16 Salmonella agona (strain SL483)
A1RMB8 7.78e-41 131 76 0 81 3 rpsP Small ribosomal subunit protein bS16 Shewanella sp. (strain W3-18-1)
A4Y4L3 7.78e-41 131 76 0 81 3 rpsP Small ribosomal subunit protein bS16 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A0KZM3 8.91e-41 131 76 0 82 3 rpsP Small ribosomal subunit protein bS16 Shewanella sp. (strain ANA-3)
Q8EH72 8.91e-41 131 76 0 82 3 rpsP Small ribosomal subunit protein bS16 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A9L5P5 8.97e-41 131 76 0 81 3 rpsP Small ribosomal subunit protein bS16 Shewanella baltica (strain OS195)
A6WKR6 8.97e-41 131 76 0 81 3 rpsP Small ribosomal subunit protein bS16 Shewanella baltica (strain OS185)
A3D1W5 8.97e-41 131 76 0 81 3 rpsP Small ribosomal subunit protein bS16 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBP3 8.97e-41 131 76 0 81 3 rpsP Small ribosomal subunit protein bS16 Shewanella baltica (strain OS223)
B8F7X5 9.51e-41 131 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Glaesserella parasuis serovar 5 (strain SH0165)
Q0HSK1 2.29e-40 130 75 0 82 3 rpsP Small ribosomal subunit protein bS16 Shewanella sp. (strain MR-7)
Q0HGA8 2.29e-40 130 75 0 82 3 rpsP Small ribosomal subunit protein bS16 Shewanella sp. (strain MR-4)
Q5QUU8 2.95e-40 130 71 0 82 3 rpsP Small ribosomal subunit protein bS16 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B0UVM6 3.47e-40 130 68 0 82 3 rpsP Small ribosomal subunit protein bS16 Histophilus somni (strain 2336)
Q0I1K0 4.47e-40 129 68 0 82 3 rpsP Small ribosomal subunit protein bS16 Histophilus somni (strain 129Pt)
C4LD27 4.67e-40 129 71 0 82 3 rpsP Small ribosomal subunit protein bS16 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A6VLP8 5.04e-40 129 71 0 82 3 rpsP Small ribosomal subunit protein bS16 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q7VKG0 5.88e-40 129 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
C3LS51 8.09e-40 129 71 0 82 3 rpsP Small ribosomal subunit protein bS16 Vibrio cholerae serotype O1 (strain M66-2)
Q9KUG0 8.09e-40 129 71 0 82 3 rpsP Small ribosomal subunit protein bS16 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F9A7 8.09e-40 129 71 0 82 3 rpsP Small ribosomal subunit protein bS16 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q3IEC9 8.27e-40 129 70 0 82 3 rpsP Small ribosomal subunit protein bS16 Pseudoalteromonas translucida (strain TAC 125)
Q3YYM9 1.95e-39 128 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Shigella sonnei (strain Ss046)
P0A7T6 1.95e-39 128 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Shigella flexneri
Q32CX9 1.95e-39 128 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Shigella dysenteriae serotype 1 (strain Sd197)
Q31XD6 1.95e-39 128 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Shigella boydii serotype 4 (strain Sb227)
B2TYN1 1.95e-39 128 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LUW4 1.95e-39 128 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LPB6 1.95e-39 128 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Escherichia coli (strain SMS-3-5 / SECEC)
B6I631 1.95e-39 128 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Escherichia coli (strain SE11)
B7N6J5 1.95e-39 128 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7T3 1.95e-39 128 73 0 82 1 rpsP Small ribosomal subunit protein bS16 Escherichia coli (strain K12)
B1IVM4 1.95e-39 128 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7T4 1.95e-39 128 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TEN0 1.95e-39 128 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A3B6 1.95e-39 128 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Escherichia coli O9:H4 (strain HS)
B1XBT1 1.95e-39 128 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Escherichia coli (strain K12 / DH10B)
C4ZYM7 1.95e-39 128 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M978 1.95e-39 128 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Escherichia coli O8 (strain IAI1)
B7MYP8 1.95e-39 128 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Escherichia coli O81 (strain ED1a)
B7NSA8 1.95e-39 128 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z228 1.95e-39 128 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7T5 1.95e-39 128 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Escherichia coli O157:H7
B7LDJ8 1.95e-39 128 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Escherichia coli (strain 55989 / EAEC)
B7MIU7 1.95e-39 128 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UH58 1.95e-39 128 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZQ49 1.95e-39 128 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Escherichia coli O139:H28 (strain E24377A / ETEC)
B0BSV8 2.12e-39 128 71 0 82 3 rpsP Small ribosomal subunit protein bS16 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZ38 2.12e-39 128 71 0 82 3 rpsP Small ribosomal subunit protein bS16 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N384 2.12e-39 128 71 0 82 3 rpsP Small ribosomal subunit protein bS16 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q65VG3 3.26e-39 127 70 0 82 3 rpsP Small ribosomal subunit protein bS16 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q87LS8 4.1e-39 127 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q15VI9 9.21e-39 126 71 0 82 3 rpsP Small ribosomal subunit protein bS16 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A7MYV1 9.45e-39 126 71 0 82 3 rpsP Small ribosomal subunit protein bS16 Vibrio campbellii (strain ATCC BAA-1116)
Q6LMV7 2.64e-38 125 73 0 82 3 rpsP Small ribosomal subunit protein bS16 Photobacterium profundum (strain SS9)
C4K8Z4 3.51e-38 125 67 0 81 3 rpsP Small ribosomal subunit protein bS16 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B7VK29 3.53e-38 125 70 0 82 3 rpsP Small ribosomal subunit protein bS16 Vibrio atlanticus (strain LGP32)
Q1LTQ9 6.37e-38 124 68 0 82 3 rpsP Small ribosomal subunit protein bS16 Baumannia cicadellinicola subsp. Homalodisca coagulata
Q6F7H9 9.36e-38 124 80 0 71 3 rpsP Small ribosomal subunit protein bS16 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q7MHT1 1.21e-37 123 69 0 82 3 rpsP Small ribosomal subunit protein bS16 Vibrio vulnificus (strain YJ016)
Q8DC33 1.21e-37 123 69 0 82 3 rpsP Small ribosomal subunit protein bS16 Vibrio vulnificus (strain CMCP6)
A6W1U2 1.17e-36 121 65 0 82 3 rpsP Small ribosomal subunit protein bS16 Marinomonas sp. (strain MWYL1)
A5EXZ1 2.85e-36 120 64 0 82 3 rpsP Small ribosomal subunit protein bS16 Dichelobacter nodosus (strain VCS1703A)
A1U2Y9 8.92e-36 119 68 0 79 3 rpsP Small ribosomal subunit protein bS16 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A1SZY8 1.51e-35 118 71 0 76 3 rpsP Small ribosomal subunit protein bS16 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B5FAE5 1.68e-35 118 69 0 82 3 rpsP Small ribosomal subunit protein bS16 Aliivibrio fischeri (strain MJ11)
Q5E7F2 1.68e-35 118 69 0 82 3 rpsP Small ribosomal subunit protein bS16 Aliivibrio fischeri (strain ATCC 700601 / ES114)
A4IWA5 2.7e-35 117 65 0 82 3 rpsP Small ribosomal subunit protein bS16 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NIC6 2.7e-35 117 65 0 82 3 rpsP Small ribosomal subunit protein bS16 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
A0Q861 2.7e-35 117 65 0 82 3 rpsP Small ribosomal subunit protein bS16 Francisella tularensis subsp. novicida (strain U112)
B2SFE2 2.7e-35 117 65 0 82 3 rpsP Small ribosomal subunit protein bS16 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q14JS9 2.7e-35 117 65 0 82 3 rpsP Small ribosomal subunit protein bS16 Francisella tularensis subsp. tularensis (strain FSC 198)
B4RIW5 3.26e-35 117 68 0 79 3 rpsP Small ribosomal subunit protein bS16 Neisseria gonorrhoeae (strain NCCP11945)
Q5FA57 3.26e-35 117 68 0 79 3 rpsP Small ribosomal subunit protein bS16 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A1KSK1 3.64e-35 117 68 0 79 3 rpsP Small ribosomal subunit protein bS16 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P66438 3.64e-35 117 68 0 79 3 rpsP Small ribosomal subunit protein bS16 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66437 3.64e-35 117 68 0 79 3 rpsP Small ribosomal subunit protein bS16 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M2D3 3.64e-35 117 68 0 79 3 rpsP Small ribosomal subunit protein bS16 Neisseria meningitidis serogroup C (strain 053442)
Q1QT48 3.65e-35 117 65 0 81 3 rpsP Small ribosomal subunit protein bS16 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q47BI5 6.72e-35 116 69 0 76 3 rpsP Small ribosomal subunit protein bS16 Dechloromonas aromatica (strain RCB)
B0TX16 8.08e-35 116 65 0 82 3 rpsP Small ribosomal subunit protein bS16 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q21LG4 1.19e-34 115 63 0 82 3 rpsP Small ribosomal subunit protein bS16 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q02RL8 1.49e-34 115 65 0 81 3 rpsP Small ribosomal subunit protein bS16 Pseudomonas aeruginosa (strain UCBPP-PA14)
C1DDY7 2.84e-34 115 64 0 81 3 rpsP Small ribosomal subunit protein bS16 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q2SL58 3.37e-34 114 66 0 78 3 rpsP Small ribosomal subunit protein bS16 Hahella chejuensis (strain KCTC 2396)
Q0BKD1 6.35e-34 114 64 0 82 3 rpsP Small ribosomal subunit protein bS16 Francisella tularensis subsp. holarctica (strain OSU18)
Q2A1N3 6.35e-34 114 64 0 82 3 rpsP Small ribosomal subunit protein bS16 Francisella tularensis subsp. holarctica (strain LVS)
A7NEB3 6.35e-34 114 64 0 82 3 rpsP Small ribosomal subunit protein bS16 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q9HXP9 7.3e-34 114 64 0 81 1 rpsP Small ribosomal subunit protein bS16 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B7UYK6 7.3e-34 114 64 0 81 3 rpsP Small ribosomal subunit protein bS16 Pseudomonas aeruginosa (strain LESB58)
A6V123 7.3e-34 114 64 0 81 3 rpsP Small ribosomal subunit protein bS16 Pseudomonas aeruginosa (strain PA7)
C5BR73 1.39e-33 113 65 0 78 3 rpsP Small ribosomal subunit protein bS16 Teredinibacter turnerae (strain ATCC 39867 / T7901)
Q1GYT6 1.67e-33 113 68 0 82 3 rpsP Small ribosomal subunit protein bS16 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q60BS3 4.95e-33 112 64 0 81 3 rpsP Small ribosomal subunit protein bS16 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q31HY0 5.63e-33 111 63 0 80 3 rpsP Small ribosomal subunit protein bS16 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q1I5Y8 6.69e-33 111 65 0 76 3 rpsP Small ribosomal subunit protein bS16 Pseudomonas entomophila (strain L48)
B4SPH1 9.18e-33 111 64 0 81 3 rpsP Small ribosomal subunit protein bS16 Stenotrophomonas maltophilia (strain R551-3)
B1JDE5 1.31e-32 110 65 0 76 3 rpsP Small ribosomal subunit protein bS16 Pseudomonas putida (strain W619)
Q88MV6 1.64e-32 110 65 0 76 3 rpsP Small ribosomal subunit protein bS16 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KRI1 1.64e-32 110 65 0 76 3 rpsP Small ribosomal subunit protein bS16 Pseudomonas putida (strain GB-1)
A5W8C3 1.64e-32 110 65 0 76 3 rpsP Small ribosomal subunit protein bS16 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q0AIU9 1.86e-32 110 65 0 76 3 rpsP Small ribosomal subunit protein bS16 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
B2FUB3 3.39e-32 110 62 0 81 3 rpsP Small ribosomal subunit protein bS16 Stenotrophomonas maltophilia (strain K279a)
Q7NRV5 4.66e-32 109 64 0 79 3 rpsP Small ribosomal subunit protein bS16 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q82U38 5.41e-32 109 63 0 77 3 rpsP Small ribosomal subunit protein bS16 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A4XXT7 5.81e-32 109 64 0 76 3 rpsP Small ribosomal subunit protein bS16 Pseudomonas mendocina (strain ymp)
A4VIT5 7e-32 108 63 0 76 3 rpsP Small ribosomal subunit protein bS16 Stutzerimonas stutzeri (strain A1501)
B8D7S9 7.87e-32 108 59 0 79 3 rpsP Small ribosomal subunit protein bS16 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57474 7.87e-32 108 59 0 79 3 rpsP Small ribosomal subunit protein bS16 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9H7 7.87e-32 108 59 0 79 3 rpsP Small ribosomal subunit protein bS16 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A9IK34 8.05e-32 108 63 1 84 3 rpsP Small ribosomal subunit protein bS16 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
C1DBF8 8.09e-32 108 67 0 76 3 rpsP Small ribosomal subunit protein bS16 Laribacter hongkongensis (strain HLHK9)
Q1Q8A4 9.27e-32 108 63 0 82 3 rpsP Small ribosomal subunit protein bS16 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FQ42 9.27e-32 108 63 0 82 3 rpsP Small ribosomal subunit protein bS16 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q0VRF2 1.18e-31 108 60 0 82 3 rpsP Small ribosomal subunit protein bS16 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
B1Y0H5 1.77e-31 108 60 0 79 3 rpsP Small ribosomal subunit protein bS16 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
B0U288 1.83e-31 108 61 0 81 3 rpsP Small ribosomal subunit protein bS16 Xylella fastidiosa (strain M12)
Q3J8X8 1.97e-31 107 62 0 77 3 rpsP Small ribosomal subunit protein bS16 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A5WBW8 2.8e-31 107 62 0 81 3 rpsP Small ribosomal subunit protein bS16 Psychrobacter sp. (strain PRwf-1)
Q9PH39 3.03e-31 107 60 0 81 3 rpsP Small ribosomal subunit protein bS16 Xylella fastidiosa (strain 9a5c)
A2SES6 3.95e-31 107 62 0 79 3 rpsP Small ribosomal subunit protein bS16 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q87F56 4.71e-31 107 60 0 81 3 rpsP Small ribosomal subunit protein bS16 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I6A6 4.71e-31 107 60 0 81 3 rpsP Small ribosomal subunit protein bS16 Xylella fastidiosa (strain M23)
Q2KY79 4.76e-31 107 63 1 84 3 rpsP Small ribosomal subunit protein bS16 Bordetella avium (strain 197N)
A1WUF4 5.73e-31 107 56 0 81 3 rpsP Small ribosomal subunit protein bS16 Halorhodospira halophila (strain DSM 244 / SL1)
Q8PBC3 6.61e-31 106 60 0 81 3 rpsP Small ribosomal subunit protein bS16 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RXD9 6.61e-31 106 60 0 81 3 rpsP Small ribosomal subunit protein bS16 Xanthomonas campestris pv. campestris (strain B100)
Q4US82 6.61e-31 106 60 0 81 3 rpsP Small ribosomal subunit protein bS16 Xanthomonas campestris pv. campestris (strain 8004)
A4G2T5 7.9e-31 106 60 0 82 3 rpsP Small ribosomal subunit protein bS16 Herminiimonas arsenicoxydans
Q7VXD8 9.7e-31 106 61 1 84 3 rpsP Small ribosomal subunit protein bS16 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WHL9 9.7e-31 106 61 1 84 3 rpsP Small ribosomal subunit protein bS16 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q0KD81 1.75e-30 105 63 0 82 3 rpsP Small ribosomal subunit protein bS16 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q2YBJ4 2.45e-30 105 65 0 76 3 rpsP Small ribosomal subunit protein bS16 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q8Y0W0 2.54e-30 105 62 0 82 3 rpsP Small ribosomal subunit protein bS16 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q7VQG0 3.23e-30 104 60 0 79 3 rpsP Small ribosomal subunit protein bS16 Blochmanniella floridana
Q83E83 3.54e-30 106 60 0 81 3 rpsP Small ribosomal subunit protein bS16 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NBR1 3.54e-30 106 60 0 81 3 rpsP Small ribosomal subunit protein bS16 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KEE7 3.54e-30 106 60 0 81 3 rpsP Small ribosomal subunit protein bS16 Coxiella burnetii (strain Dugway 5J108-111)
Q3BVZ0 4.48e-30 104 58 0 82 3 rpsP Small ribosomal subunit protein bS16 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PMY3 4.48e-30 104 58 0 82 3 rpsP Small ribosomal subunit protein bS16 Xanthomonas axonopodis pv. citri (strain 306)
Q1BY04 5.48e-30 104 62 1 81 3 rpsP Small ribosomal subunit protein bS16 Burkholderia orbicola (strain AU 1054)
B1JXU3 5.48e-30 104 62 1 81 3 rpsP Small ribosomal subunit protein bS16 Burkholderia orbicola (strain MC0-3)
Q39ID6 5.48e-30 104 62 1 81 3 rpsP Small ribosomal subunit protein bS16 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q0BH69 5.48e-30 104 62 1 81 3 rpsP Small ribosomal subunit protein bS16 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B4EAN6 5.48e-30 104 62 1 81 3 rpsP Small ribosomal subunit protein bS16 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K5P5 5.48e-30 104 62 1 81 3 rpsP Small ribosomal subunit protein bS16 Burkholderia cenocepacia (strain HI2424)
B1YV57 5.48e-30 104 62 1 81 3 rpsP Small ribosomal subunit protein bS16 Burkholderia ambifaria (strain MC40-6)
B3R396 6.01e-30 104 62 0 82 3 rpsP Small ribosomal subunit protein bS16 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q2SY01 7.95e-30 103 62 1 81 3 rpsP Small ribosomal subunit protein bS16 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63S30 7.95e-30 103 62 1 81 3 rpsP Small ribosomal subunit protein bS16 Burkholderia pseudomallei (strain K96243)
A3NC07 7.95e-30 103 62 1 81 3 rpsP Small ribosomal subunit protein bS16 Burkholderia pseudomallei (strain 668)
Q3JQ06 7.95e-30 103 62 1 81 3 rpsP Small ribosomal subunit protein bS16 Burkholderia pseudomallei (strain 1710b)
A3NXU3 7.95e-30 103 62 1 81 3 rpsP Small ribosomal subunit protein bS16 Burkholderia pseudomallei (strain 1106a)
A1V6J4 7.95e-30 103 62 1 81 3 rpsP Small ribosomal subunit protein bS16 Burkholderia mallei (strain SAVP1)
Q62M50 7.95e-30 103 62 1 81 3 rpsP Small ribosomal subunit protein bS16 Burkholderia mallei (strain ATCC 23344)
A2S4P0 7.95e-30 103 62 1 81 3 rpsP Small ribosomal subunit protein bS16 Burkholderia mallei (strain NCTC 10229)
A3MHR7 7.95e-30 103 62 1 81 3 rpsP Small ribosomal subunit protein bS16 Burkholderia mallei (strain NCTC 10247)
A9ADT1 7.95e-30 103 62 1 81 3 rpsP Small ribosomal subunit protein bS16 Burkholderia multivorans (strain ATCC 17616 / 249)
Q9L9C8 9.19e-30 103 63 1 76 3 rpsP Small ribosomal subunit protein bS16 Acidithiobacillus ferridurans
B5EPD0 9.19e-30 103 63 1 76 3 rpsP Small ribosomal subunit protein bS16 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J948 9.19e-30 103 63 1 76 3 rpsP Small ribosomal subunit protein bS16 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
B2U8B2 1.42e-29 103 62 0 82 3 rpsP Small ribosomal subunit protein bS16 Ralstonia pickettii (strain 12J)
Q7W6N6 1.5e-29 103 60 1 84 3 rpsP Small ribosomal subunit protein bS16 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q13VE8 1.68e-29 103 62 1 81 3 rpsP Small ribosomal subunit protein bS16 Paraburkholderia xenovorans (strain LB400)
B2T607 1.68e-29 103 62 1 81 3 rpsP Small ribosomal subunit protein bS16 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q46Y82 2.35e-29 102 62 1 83 3 rpsP Small ribosomal subunit protein bS16 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q5H392 2.48e-29 102 57 0 82 3 rpsP Small ribosomal subunit protein bS16 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SJV3 2.48e-29 102 57 0 82 3 rpsP Small ribosomal subunit protein bS16 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P653 2.48e-29 102 57 0 82 3 rpsP Small ribosomal subunit protein bS16 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q5WZE0 2.66e-29 102 53 0 82 3 rpsP Small ribosomal subunit protein bS16 Legionella pneumophila (strain Lens)
Q5ZYH3 2.66e-29 102 53 0 82 3 rpsP Small ribosomal subunit protein bS16 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IHJ5 2.66e-29 102 53 0 82 3 rpsP Small ribosomal subunit protein bS16 Legionella pneumophila (strain Corby)
Q5X7Y9 2.66e-29 102 53 0 82 3 rpsP Small ribosomal subunit protein bS16 Legionella pneumophila (strain Paris)
A1K9K9 3.29e-29 102 58 0 82 3 rpsP Small ribosomal subunit protein bS16 Azoarcus sp. (strain BH72)
B2JF29 3.57e-29 102 61 1 81 3 rpsP Small ribosomal subunit protein bS16 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
B8GN76 4.91e-29 102 55 0 81 3 rpsP Small ribosomal subunit protein bS16 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q21YL8 1.27e-28 100 58 0 82 3 rpsP Small ribosomal subunit protein bS16 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q4ZWY9 8e-28 99 56 0 81 3 rpsP Small ribosomal subunit protein bS16 Pseudomonas syringae pv. syringae (strain B728a)
Q48LW0 8e-28 99 56 0 81 3 rpsP Small ribosomal subunit protein bS16 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q886V2 1.09e-27 98 55 0 81 3 rpsP Small ribosomal subunit protein bS16 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4KHQ8 1.32e-27 98 56 0 82 3 rpsP Small ribosomal subunit protein bS16 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q5LNF2 2.02e-27 99 55 1 78 3 rpsP Small ribosomal subunit protein bS16 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q3KHJ4 2.31e-27 97 56 0 82 3 rpsP Small ribosomal subunit protein bS16 Pseudomonas fluorescens (strain Pf0-1)
Q493M3 2.32e-27 97 58 1 79 3 rpsP Small ribosomal subunit protein bS16 Blochmanniella pennsylvanica (strain BPEN)
C3K1H1 2.64e-27 97 56 0 82 3 rpsP Small ribosomal subunit protein bS16 Pseudomonas fluorescens (strain SBW25)
Q13DU2 2.81e-27 98 60 1 78 3 rpsP Small ribosomal subunit protein bS16 Rhodopseudomonas palustris (strain BisB5)
B3Q856 3.29e-27 97 60 1 78 3 rpsP Small ribosomal subunit protein bS16 Rhodopseudomonas palustris (strain TIE-1)
P62236 3.29e-27 97 60 1 78 1 rpsP Small ribosomal subunit protein bS16 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q12CW6 4.37e-27 97 56 0 82 3 rpsP Small ribosomal subunit protein bS16 Polaromonas sp. (strain JS666 / ATCC BAA-500)
A5G0H0 4.44e-27 97 57 1 78 3 rpsP Small ribosomal subunit protein bS16 Acidiphilium cryptum (strain JF-5)
A1VM97 6.03e-27 97 57 0 78 3 rpsP Small ribosomal subunit protein bS16 Polaromonas naphthalenivorans (strain CJ2)
A6WXU5 1.28e-26 97 52 1 86 3 rpsP Small ribosomal subunit protein bS16 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q5NXM7 1.44e-26 95 60 0 74 3 rpsP Small ribosomal subunit protein bS16 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q16AN8 1.59e-26 96 53 1 78 3 rpsP Small ribosomal subunit protein bS16 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q057I5 1.59e-26 95 45 0 80 3 rpsP Small ribosomal subunit protein bS16 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q28UE6 1.62e-26 97 51 1 78 3 rpsP Small ribosomal subunit protein bS16 Jannaschia sp. (strain CCS1)
Q2J397 1.65e-26 96 61 1 75 3 rpsP Small ribosomal subunit protein bS16 Rhodopseudomonas palustris (strain HaA2)
Q1QHI9 2.41e-26 95 57 1 78 3 rpsP Small ribosomal subunit protein bS16 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A7HT06 5.53e-26 95 53 1 78 3 rpsP Small ribosomal subunit protein bS16 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A7HBP8 1e-25 93 54 1 81 3 rpsP Small ribosomal subunit protein bS16 Anaeromyxobacter sp. (strain Fw109-5)
A8LMC0 1.28e-25 94 50 1 79 3 rpsP Small ribosomal subunit protein bS16 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q3SNV8 1.47e-25 94 57 1 78 3 rpsP Small ribosomal subunit protein bS16 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q8D2V3 1.51e-25 92 45 0 80 3 rpsP Small ribosomal subunit protein bS16 Wigglesworthia glossinidia brevipalpis
A1WPT9 1.57e-25 93 56 0 81 3 rpsP Small ribosomal subunit protein bS16 Verminephrobacter eiseniae (strain EF01-2)
B1XVN3 2e-25 92 53 0 77 3 rpsP Small ribosomal subunit protein bS16 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
A4SW73 2e-25 92 53 0 77 3 rpsP Small ribosomal subunit protein bS16 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q21CT9 2.01e-25 93 58 1 78 3 rpsP Small ribosomal subunit protein bS16 Rhodopseudomonas palustris (strain BisB18)
Q5HC44 3.21e-25 92 59 1 76 3 rpsP Small ribosomal subunit protein bS16 Ehrlichia ruminantium (strain Welgevonden)
A8F0A2 3.54e-25 93 57 1 78 3 rpsP Small ribosomal subunit protein bS16 Rickettsia canadensis (strain McKiel)
C0RF74 3.71e-25 93 53 0 77 3 rpsP Small ribosomal subunit protein bS16 Brucella melitensis biotype 2 (strain ATCC 23457)
A1AXN9 3.75e-25 92 53 1 80 3 rpsP Small ribosomal subunit protein bS16 Ruthia magnifica subsp. Calyptogena magnifica
A9HS66 4.26e-25 92 53 1 78 3 rpsP Small ribosomal subunit protein bS16 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q57B65 4.33e-25 93 53 0 77 3 rpsP Small ribosomal subunit protein bS16 Brucella abortus biovar 1 (strain 9-941)
Q2YLK6 4.33e-25 93 53 0 77 3 rpsP Small ribosomal subunit protein bS16 Brucella abortus (strain 2308)
B2S7P8 4.33e-25 93 53 0 77 3 rpsP Small ribosomal subunit protein bS16 Brucella abortus (strain S19)
Q5FFA8 4.41e-25 92 57 1 76 3 rpsP Small ribosomal subunit protein bS16 Ehrlichia ruminantium (strain Gardel)
Q68VN6 4.5e-25 92 56 1 78 3 rpsP Small ribosomal subunit protein bS16 Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q0AKL6 4.56e-25 94 52 0 74 3 rpsP Small ribosomal subunit protein bS16 Maricaulis maris (strain MCS10)
A9BNS9 5.06e-25 91 56 0 80 3 rpsP Small ribosomal subunit protein bS16 Delftia acidovorans (strain DSM 14801 / SPH-1)
Q1GDC7 5.09e-25 92 50 1 78 3 rpsP Small ribosomal subunit protein bS16 Ruegeria sp. (strain TM1040)
P66434 5.16e-25 93 53 0 77 3 rpsP Small ribosomal subunit protein bS16 Brucella suis biovar 1 (strain 1330)
A5VSG4 5.16e-25 93 53 0 77 3 rpsP Small ribosomal subunit protein bS16 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P66433 5.16e-25 93 53 0 77 3 rpsP Small ribosomal subunit protein bS16 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
A9M862 5.16e-25 93 53 0 77 3 rpsP Small ribosomal subunit protein bS16 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
C3MAG3 5.64e-25 92 49 2 87 3 rpsP Small ribosomal subunit protein bS16 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q92L43 5.83e-25 92 51 1 78 3 rpsP Small ribosomal subunit protein bS16 Rhizobium meliloti (strain 1021)
Q8K9F6 6.13e-25 91 52 0 76 3 rpsP Small ribosomal subunit protein bS16 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q07UU7 6.56e-25 92 58 1 78 3 rpsP Small ribosomal subunit protein bS16 Rhodopseudomonas palustris (strain BisA53)
A9WWU9 6.85e-25 92 53 0 77 3 rpsP Small ribosomal subunit protein bS16 Brucella suis (strain ATCC 23445 / NCTC 10510)
Q4UJQ3 7.36e-25 92 57 1 78 3 rpsP Small ribosomal subunit protein bS16 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
A4WNX7 9.84e-25 92 50 1 78 3 rpsP Small ribosomal subunit protein bS16 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q3IZ02 1.04e-24 92 50 1 78 3 rpsP Small ribosomal subunit protein bS16 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PN95 1.04e-24 92 50 1 78 3 rpsP Small ribosomal subunit protein bS16 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
C5CSM6 1.07e-24 90 56 0 76 3 rpsP Small ribosomal subunit protein bS16 Variovorax paradoxus (strain S110)
A8GQA7 1.22e-24 91 56 1 78 3 rpsP Small ribosomal subunit protein bS16 Rickettsia akari (strain Hartford)
Q5FUG0 1.23e-24 91 53 1 78 3 rpsP Small ribosomal subunit protein bS16 Gluconobacter oxydans (strain 621H)
Q9ZC90 1.48e-24 91 56 1 78 3 rpsP Small ribosomal subunit protein bS16 Rickettsia prowazekii (strain Madrid E)
B6JAQ4 1.54e-24 91 56 1 78 3 rpsP Small ribosomal subunit protein bS16 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
A4YKA0 1.66e-24 91 56 1 78 3 rpsP Small ribosomal subunit protein bS16 Bradyrhizobium sp. (strain ORS 278)
Q89X40 1.72e-24 91 56 1 78 3 rpsP Small ribosomal subunit protein bS16 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A5E910 1.94e-24 91 56 1 78 3 rpsP Small ribosomal subunit protein bS16 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q98E70 2.14e-24 91 50 0 77 3 rpsP Small ribosomal subunit protein bS16 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A6UE43 3.81e-24 90 49 2 87 3 rpsP Small ribosomal subunit protein bS16 Sinorhizobium medicae (strain WSM419)
Q3YSX5 3.82e-24 89 56 1 76 3 rpsP Small ribosomal subunit protein bS16 Ehrlichia canis (strain Jake)
A5V9P7 3.92e-24 91 53 1 78 3 rpsP Small ribosomal subunit protein bS16 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
B9JCL9 3.94e-24 90 51 1 78 3 rpsP Small ribosomal subunit protein bS16 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
A8GU56 4.1e-24 90 56 1 78 3 rpsP Small ribosomal subunit protein bS16 Rickettsia rickettsii (strain Sheila Smith)
B0BVP5 4.1e-24 90 56 1 78 3 rpsP Small ribosomal subunit protein bS16 Rickettsia rickettsii (strain Iowa)
C4K2Y3 4.1e-24 90 56 1 78 3 rpsP Small ribosomal subunit protein bS16 Rickettsia peacockii (strain Rustic)
Q92FW8 4.1e-24 90 56 1 78 3 rpsP Small ribosomal subunit protein bS16 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
C3PM20 4.1e-24 90 56 1 78 3 rpsP Small ribosomal subunit protein bS16 Rickettsia africae (strain ESF-5)
A5CVN0 4.43e-24 89 50 0 79 3 rpsP Small ribosomal subunit protein bS16 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A1B8V3 4.44e-24 90 50 1 78 3 rpsP Small ribosomal subunit protein bS16 Paracoccus denitrificans (strain Pd 1222)
Q2GHR7 4.45e-24 89 55 1 76 3 rpsP Small ribosomal subunit protein bS16 Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
B8EIS6 4.54e-24 90 57 1 75 3 rpsP Small ribosomal subunit protein bS16 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q4FP12 5.17e-24 92 53 1 76 3 rpsP Small ribosomal subunit protein bS16 Pelagibacter ubique (strain HTCC1062)
A1WB52 5.85e-24 89 54 0 82 3 rpsP Small ribosomal subunit protein bS16 Acidovorax sp. (strain JS42)
B9ME99 5.85e-24 89 54 0 82 3 rpsP Small ribosomal subunit protein bS16 Acidovorax ebreus (strain TPSY)
Q89AE3 6.32e-24 89 48 1 77 3 rpsP Small ribosomal subunit protein bS16 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A1UR04 7.34e-24 90 46 0 77 3 rpsP Small ribosomal subunit protein bS16 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
A8ZV23 9.12e-24 88 58 1 75 3 rpsP Small ribosomal subunit protein bS16 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
A8F2Z8 1.13e-23 89 56 1 78 3 rpsP Small ribosomal subunit protein bS16 Rickettsia massiliae (strain Mtu5)
B9JUC4 1.17e-23 89 48 2 87 3 rpsP Small ribosomal subunit protein bS16 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
A1TND0 1.29e-23 88 57 0 75 3 rpsP Small ribosomal subunit protein bS16 Paracidovorax citrulli (strain AAC00-1)
Q2VZV8 1.33e-23 89 57 1 71 3 rpsP Small ribosomal subunit protein bS16 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
B2IDX7 1.92e-23 89 54 1 75 3 rpsP Small ribosomal subunit protein bS16 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
B3CPY0 4.18e-23 87 55 1 77 3 rpsP Small ribosomal subunit protein bS16 Wolbachia pipientis subsp. Culex pipiens (strain wPip)
Q1RGQ5 4.89e-23 87 56 1 78 3 rpsP Small ribosomal subunit protein bS16 Rickettsia bellii (strain RML369-C)
A8GY79 4.89e-23 87 56 1 78 3 rpsP Small ribosomal subunit protein bS16 Rickettsia bellii (strain OSU 85-389)
Q11D15 6.11e-23 88 46 1 86 3 rpsP Small ribosomal subunit protein bS16 Chelativorans sp. (strain BNC1)
A8IKU6 6.13e-23 87 51 1 78 3 rpsP Small ribosomal subunit protein bS16 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q5FJK5 7.38e-23 86 50 1 77 3 rpsP Small ribosomal subunit protein bS16 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
A7IFB8 7.67e-23 87 50 1 78 3 rpsP Small ribosomal subunit protein bS16 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
A8YVT4 9.5e-23 86 50 1 77 3 rpsP Small ribosomal subunit protein bS16 Lactobacillus helveticus (strain DPC 4571)
Q5NNL0 1.02e-22 87 50 1 78 3 rpsP Small ribosomal subunit protein bS16 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
B0K9W7 1.22e-22 85 52 1 75 3 rpsP Small ribosomal subunit protein bS16 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
B0K1V0 1.32e-22 85 52 1 75 3 rpsP Small ribosomal subunit protein bS16 Thermoanaerobacter sp. (strain X514)
C0R3M3 1.42e-22 86 54 1 77 3 rpsP Small ribosomal subunit protein bS16 Wolbachia sp. subsp. Drosophila simulans (strain wRi)
P62240 1.42e-22 86 54 1 77 3 rpsP Small ribosomal subunit protein bS16 Wolbachia pipientis wMel
B9L6B5 1.81e-22 85 49 1 81 3 rpsP Small ribosomal subunit protein bS16 Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Q8UBZ9 1.87e-22 86 49 2 87 3 rpsP Small ribosomal subunit protein bS16 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q5GSA5 2.04e-22 85 55 1 77 3 rpsP Small ribosomal subunit protein bS16 Wolbachia sp. subsp. Brugia malayi (strain TRS)
Q049R6 2.11e-22 85 50 1 77 3 rpsP Small ribosomal subunit protein bS16 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1G9L2 2.11e-22 85 50 1 77 3 rpsP Small ribosomal subunit protein bS16 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
B0T562 2.49e-22 87 53 1 76 3 rpsP Small ribosomal subunit protein bS16 Caulobacter sp. (strain K31)
B6IP92 2.78e-22 85 52 1 78 3 rpsP Small ribosomal subunit protein bS16 Rhodospirillum centenum (strain ATCC 51521 / SW)
Q5PBU9 2.89e-22 85 52 1 76 3 rpsP Small ribosomal subunit protein bS16 Anaplasma marginale (strain St. Maries)
B9KHH1 2.89e-22 85 52 1 76 3 rpsP Small ribosomal subunit protein bS16 Anaplasma marginale (strain Florida)
B4UBC9 2.9e-22 85 52 1 75 3 rpsP Small ribosomal subunit protein bS16 Anaeromyxobacter sp. (strain K)
Q2IJ60 2.9e-22 85 52 1 75 3 rpsP Small ribosomal subunit protein bS16 Anaeromyxobacter dehalogenans (strain 2CP-C)
B8J890 2.9e-22 85 52 1 75 3 rpsP Small ribosomal subunit protein bS16 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q6G5S7 3.99e-22 85 42 0 77 3 rpsP Small ribosomal subunit protein bS16 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q6FYF9 4.38e-22 85 47 0 70 3 rpsP Small ribosomal subunit protein bS16 Bartonella quintana (strain Toulouse)
A9F3P4 4.4e-22 84 54 1 77 3 rpsP Small ribosomal subunit protein bS16 Sorangium cellulosum (strain So ce56)
B8GVS9 4.54e-22 86 52 1 76 3 rpsP Small ribosomal subunit protein bS16 Caulobacter vibrioides (strain NA1000 / CB15N)
P58122 4.54e-22 86 52 1 76 3 rpsP Small ribosomal subunit protein bS16 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q1D6I5 5.6e-22 84 51 1 80 3 rpsP Small ribosomal subunit protein bS16 Myxococcus xanthus (strain DK1622)
P62231 6.31e-22 84 49 1 77 3 rpsP Small ribosomal subunit protein bS16 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q044E5 6.31e-22 84 49 1 77 3 rpsP Small ribosomal subunit protein bS16 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q8R9X1 6.39e-22 84 50 1 75 3 rpsP Small ribosomal subunit protein bS16 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A9IZE1 7.9e-22 84 44 0 77 3 rpsP Small ribosomal subunit protein bS16 Bartonella tribocorum (strain CIP 105476 / IBS 506)
B1KWN8 8.14e-22 83 49 1 77 3 rpsP Small ribosomal subunit protein bS16 Clostridium botulinum (strain Loch Maree / Type A3)
A7GG36 8.14e-22 83 49 1 77 3 rpsP Small ribosomal subunit protein bS16 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1II79 8.14e-22 83 49 1 77 3 rpsP Small ribosomal subunit protein bS16 Clostridium botulinum (strain Okra / Type B1)
C1FSL8 8.14e-22 83 49 1 77 3 rpsP Small ribosomal subunit protein bS16 Clostridium botulinum (strain Kyoto / Type A2)
A3DDH5 1.15e-21 83 52 1 75 3 rpsP Small ribosomal subunit protein bS16 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q17WB9 1.17e-21 83 50 1 78 3 rpsP Small ribosomal subunit protein bS16 Helicobacter acinonychis (strain Sheeba)
Q1CSB5 1.31e-21 82 50 1 78 3 rpsP Small ribosomal subunit protein bS16 Helicobacter pylori (strain HPAG1)
Q1MAK5 1.39e-21 84 46 1 78 3 rpsP Small ribosomal subunit protein bS16 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q9ZK63 1.46e-21 82 51 1 78 3 rpsP Small ribosomal subunit protein bS16 Helicobacter pylori (strain J99 / ATCC 700824)
Q03W45 1.63e-21 84 51 1 77 3 rpsP Small ribosomal subunit protein bS16 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
B8FNP6 1.82e-21 82 52 1 76 3 rpsP Small ribosomal subunit protein bS16 Desulfatibacillum aliphaticivorans
B5ZTH8 1.84e-21 84 46 1 78 3 rpsP Small ribosomal subunit protein bS16 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
C3L0E6 2.13e-21 82 48 1 77 3 rpsP Small ribosomal subunit protein bS16 Clostridium botulinum (strain 657 / Type Ba4)
A7FW12 2.13e-21 82 48 1 77 3 rpsP Small ribosomal subunit protein bS16 Clostridium botulinum (strain ATCC 19397 / Type A)
P56023 2.26e-21 82 50 1 78 3 rpsP Small ribosomal subunit protein bS16 Helicobacter pylori (strain ATCC 700392 / 26695)
B2UUR0 2.26e-21 82 50 1 78 3 rpsP Small ribosomal subunit protein bS16 Helicobacter pylori (strain Shi470)
B6JMZ1 2.26e-21 82 50 1 78 3 rpsP Small ribosomal subunit protein bS16 Helicobacter pylori (strain P12)
Q2G8H4 2.31e-21 84 48 1 78 3 rpsP Small ribosomal subunit protein bS16 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q97I97 2.37e-21 82 52 1 75 3 rpsP Small ribosomal subunit protein bS16 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B2G821 2.84e-21 82 51 1 77 3 rpsP Small ribosomal subunit protein bS16 Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VKN7 2.84e-21 82 51 1 77 3 rpsP Small ribosomal subunit protein bS16 Limosilactobacillus reuteri (strain DSM 20016)
Q2K382 3.52e-21 83 46 1 78 3 rpsP Small ribosomal subunit protein bS16 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PR16 3.62e-21 83 46 1 78 3 rpsP Small ribosomal subunit protein bS16 Rhizobium etli (strain CIAT 652)
A6TRS9 4.93e-21 81 48 1 76 3 rpsP Small ribosomal subunit protein bS16 Alkaliphilus metalliredigens (strain QYMF)
A6Q552 6.24e-21 81 52 1 74 3 rpsP Small ribosomal subunit protein bS16 Nitratiruptor sp. (strain SB155-2)
B0UCL4 6.41e-21 82 46 1 78 3 rpsP Small ribosomal subunit protein bS16 Methylobacterium sp. (strain 4-46)
B5Z8E7 7.03e-21 80 50 1 78 3 rpsP Small ribosomal subunit protein bS16 Helicobacter pylori (strain G27)
B1MZU5 7.84e-21 82 51 1 77 3 rpsP Small ribosomal subunit protein bS16 Leuconostoc citreum (strain KM20)
B9KCN0 8.29e-21 80 48 1 74 3 rpsP Small ribosomal subunit protein bS16 Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060)
B3E5S3 8.4e-21 81 53 1 73 3 rpsP Small ribosomal subunit protein bS16 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
A0L4Y6 8.8e-21 80 48 1 81 3 rpsP Small ribosomal subunit protein bS16 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
B2GD28 9.67e-21 81 49 1 77 3 rpsP Small ribosomal subunit protein bS16 Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
B4RCD1 1.07e-20 83 50 1 73 3 rpsP Small ribosomal subunit protein bS16 Phenylobacterium zucineum (strain HLK1)
B0S044 1.22e-20 80 47 1 76 3 rpsP Small ribosomal subunit protein bS16 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
B8IGW4 1.3e-20 81 44 1 78 3 rpsP Small ribosomal subunit protein bS16 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q7MSD9 1.46e-20 80 51 1 74 3 rpsP Small ribosomal subunit protein bS16 Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q038J7 1.71e-20 80 50 1 76 3 rpsP Small ribosomal subunit protein bS16 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WEU4 1.71e-20 80 50 1 76 3 rpsP Small ribosomal subunit protein bS16 Lacticaseibacillus casei (strain BL23)
A1AN03 1.93e-20 80 52 1 75 3 rpsP Small ribosomal subunit protein bS16 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
B3CRY7 2.1e-20 80 47 1 76 3 rpsP Small ribosomal subunit protein bS16 Orientia tsutsugamushi (strain Ikeda)
B8I7T2 2.31e-20 80 49 1 75 3 rpsP Small ribosomal subunit protein bS16 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
C4L601 2.42e-20 80 53 1 77 3 rpsP Small ribosomal subunit protein bS16 Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q0C671 2.82e-20 81 46 1 75 3 rpsP Small ribosomal subunit protein bS16 Hyphomonas neptunium (strain ATCC 15444)
B1ZL67 2.9e-20 80 46 1 78 3 rpsP Small ribosomal subunit protein bS16 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
Q2RV59 3.01e-20 80 52 1 75 3 rpsP Small ribosomal subunit protein bS16 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B1YIM6 3.19e-20 79 51 1 77 3 rpsP Small ribosomal subunit protein bS16 Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q2GES3 3.27e-20 79 48 2 77 3 rpsP Small ribosomal subunit protein bS16 Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
A9W0G1 4.29e-20 80 44 1 78 3 rpsP Small ribosomal subunit protein bS16 Methylorubrum extorquens (strain PA1)
B7KZ56 4.29e-20 80 44 1 78 3 rpsP Small ribosomal subunit protein bS16 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
B1LVU2 4.33e-20 80 46 1 78 3 rpsP Small ribosomal subunit protein bS16 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
B2UMG5 4.38e-20 79 46 1 80 3 rpsP Small ribosomal subunit protein bS16 Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
A5CCZ6 4.9e-20 79 46 1 76 3 rpsP Small ribosomal subunit protein bS16 Orientia tsutsugamushi (strain Boryong)
A7HKR8 4.96e-20 79 46 1 75 3 rpsP Small ribosomal subunit protein bS16 Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1)
Q2RJV7 5.13e-20 79 49 1 75 3 rpsP Small ribosomal subunit protein bS16 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q2GLR4 5.34e-20 79 48 1 76 3 rpsP Small ribosomal subunit protein bS16 Anaplasma phagocytophilum (strain HZ)
Q0SSA8 5.42e-20 79 49 1 77 3 rpsP Small ribosomal subunit protein bS16 Clostridium perfringens (strain SM101 / Type A)
Q8XJP4 5.42e-20 79 49 1 77 3 rpsP Small ribosomal subunit protein bS16 Clostridium perfringens (strain 13 / Type A)
Q0TPP1 5.42e-20 79 49 1 77 3 rpsP Small ribosomal subunit protein bS16 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
B9K8P2 6.33e-20 79 48 1 77 3 rpsP Small ribosomal subunit protein bS16 Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E)
Q9CFB2 6.74e-20 79 50 1 77 3 rpsP Small ribosomal subunit protein bS16 Lactococcus lactis subsp. lactis (strain IL1403)
C1F3B5 6.78e-20 79 48 1 76 3 rpsP Small ribosomal subunit protein bS16 Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
A8MHC1 7.78e-20 78 45 1 75 3 rpsP Small ribosomal subunit protein bS16 Alkaliphilus oremlandii (strain OhILAs)
Q38XR0 7.98e-20 79 48 1 74 3 rpsP Small ribosomal subunit protein bS16 Latilactobacillus sakei subsp. sakei (strain 23K)
A7I0V4 8e-20 78 53 1 71 3 rpsP Small ribosomal subunit protein bS16 Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
A0Q0Y3 8.56e-20 78 49 1 77 3 rpsP Small ribosomal subunit protein bS16 Clostridium novyi (strain NT)
Q5HV71 8.83e-20 78 47 1 74 3 rpsP Small ribosomal subunit protein bS16 Campylobacter jejuni (strain RM1221)
A1VZ65 8.83e-20 78 47 1 74 3 rpsP Small ribosomal subunit protein bS16 Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PPJ7 8.83e-20 78 47 1 74 3 rpsP Small ribosomal subunit protein bS16 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A7H4B5 8.83e-20 78 47 1 74 3 rpsP Small ribosomal subunit protein bS16 Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A8FLD9 8.83e-20 78 47 1 74 3 rpsP Small ribosomal subunit protein bS16 Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q8DUN9 9.41e-20 78 50 1 77 3 rpsP Small ribosomal subunit protein bS16 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
A2RJS1 1.03e-19 78 50 1 77 1 rpsP Small ribosomal subunit protein bS16 Lactococcus lactis subsp. cremoris (strain MG1363)
B9DRW3 1.14e-19 78 50 1 77 3 rpsP Small ribosomal subunit protein bS16 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
C0ZFN5 1.26e-19 78 48 1 74 3 rpsP Small ribosomal subunit protein bS16 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q1WU95 1.41e-19 78 51 1 74 3 rpsP Small ribosomal subunit protein bS16 Ligilactobacillus salivarius (strain UCC118)
Q02Y12 1.42e-19 78 50 1 77 3 rpsP Small ribosomal subunit protein bS16 Lactococcus lactis subsp. cremoris (strain SK11)
B5E375 1.6e-19 78 52 1 74 3 rpsP Small ribosomal subunit protein bS16 Streptococcus pneumoniae serotype 19F (strain G54)
C0MEH6 1.8e-19 77 51 1 77 3 rpsP Small ribosomal subunit protein bS16 Streptococcus equi subsp. zooepidemicus (strain H70)
C0M751 1.8e-19 77 51 1 77 3 rpsP Small ribosomal subunit protein bS16 Streptococcus equi subsp. equi (strain 4047)
A7NJT8 1.87e-19 77 53 1 77 3 rpsP Small ribosomal subunit protein bS16 Roseiflexus castenholzii (strain DSM 13941 / HLO8)
C1CQN4 1.95e-19 77 52 1 74 3 rpsP Small ribosomal subunit protein bS16 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CJM1 1.95e-19 77 52 1 74 3 rpsP Small ribosomal subunit protein bS16 Streptococcus pneumoniae (strain P1031)
C1CDC3 1.95e-19 77 52 1 74 3 rpsP Small ribosomal subunit protein bS16 Streptococcus pneumoniae (strain JJA)
P66445 1.95e-19 77 52 1 74 3 rpsP Small ribosomal subunit protein bS16 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P66444 1.95e-19 77 52 1 74 1 rpsP Small ribosomal subunit protein bS16 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZNC8 1.95e-19 77 52 1 74 3 rpsP Small ribosomal subunit protein bS16 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1IAU9 1.95e-19 77 52 1 74 3 rpsP Small ribosomal subunit protein bS16 Streptococcus pneumoniae (strain Hungary19A-6)
C1C6B6 1.95e-19 77 52 1 74 3 rpsP Small ribosomal subunit protein bS16 Streptococcus pneumoniae (strain 70585)
Q04LD0 1.95e-19 77 52 1 74 3 rpsP Small ribosomal subunit protein bS16 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
B2ING0 2.08e-19 77 52 1 74 3 rpsP Small ribosomal subunit protein bS16 Streptococcus pneumoniae (strain CGSP14)
Q9CPX7 2.22e-19 79 45 2 77 1 Mrps16 Small ribosomal subunit protein bS16m Mus musculus
Q7VHM7 2.23e-19 77 52 1 71 3 rpsP Small ribosomal subunit protein bS16 Helicobacter hepaticus (strain ATCC 51449 / 3B1)
B9MQW7 2.48e-19 77 45 1 77 3 rpsP Small ribosomal subunit protein bS16 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
B5XKW7 2.67e-19 77 49 1 77 3 rpsP Small ribosomal subunit protein bS16 Streptococcus pyogenes serotype M49 (strain NZ131)
P0DE77 2.67e-19 77 49 1 77 3 rpsP Small ribosomal subunit protein bS16 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48U63 2.67e-19 77 49 1 77 3 rpsP Small ribosomal subunit protein bS16 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RF55 2.67e-19 77 49 1 77 3 rpsP Small ribosomal subunit protein bS16 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J786 2.67e-19 77 49 1 77 3 rpsP Small ribosomal subunit protein bS16 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JHG4 2.67e-19 77 49 1 77 3 rpsP Small ribosomal subunit protein bS16 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JMC0 2.67e-19 77 49 1 77 3 rpsP Small ribosomal subunit protein bS16 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JCE0 2.67e-19 77 49 1 77 3 rpsP Small ribosomal subunit protein bS16 Streptococcus pyogenes serotype M12 (strain MGAS2096)
P66448 2.67e-19 77 49 1 77 3 rpsP Small ribosomal subunit protein bS16 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XCR1 2.67e-19 77 49 1 77 3 rpsP Small ribosomal subunit protein bS16 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DE76 2.67e-19 77 49 1 77 3 rpsP Small ribosomal subunit protein bS16 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P66446 2.67e-19 77 49 1 77 3 rpsP Small ribosomal subunit protein bS16 Streptococcus pyogenes serotype M1
A5UST8 3.6e-19 77 51 1 77 3 rpsP Small ribosomal subunit protein bS16 Roseiflexus sp. (strain RS-1)
P82915 3.73e-19 78 44 1 75 1 MRPS16 Small ribosomal subunit protein bS16m Bos taurus
A4XLF4 3.81e-19 77 45 1 75 3 rpsP Small ribosomal subunit protein bS16 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q5REY4 4.18e-19 78 44 1 75 2 MRPS16 Small ribosomal subunit protein bS16m Pongo abelii
A7GRH4 4.23e-19 77 51 1 76 3 rpsP Small ribosomal subunit protein bS16 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q9Y3D3 4.92e-19 78 44 1 75 1 MRPS16 Small ribosomal subunit protein bS16m Homo sapiens
Q03RU4 5.41e-19 76 49 1 77 3 rpsP Small ribosomal subunit protein bS16 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q65JQ0 6.7e-19 76 52 1 74 3 rpsP Small ribosomal subunit protein bS16 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A3CNF4 7.23e-19 76 50 1 74 3 rpsP Small ribosomal subunit protein bS16 Streptococcus sanguinis (strain SK36)
P66443 7.31e-19 76 49 1 77 3 rpsP Small ribosomal subunit protein bS16 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P66442 7.31e-19 76 49 1 77 3 rpsP Small ribosomal subunit protein bS16 Streptococcus agalactiae serotype III (strain NEM316)
Q3K0F4 7.31e-19 76 49 1 77 3 rpsP Small ribosomal subunit protein bS16 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
A0RPR9 8.06e-19 75 47 1 73 3 rpsP Small ribosomal subunit protein bS16 Campylobacter fetus subsp. fetus (strain 82-40)
B1I2P9 8.41e-19 76 48 2 79 3 rpsP Small ribosomal subunit protein bS16 Desulforudis audaxviator (strain MP104C)
Q9KA11 8.52e-19 76 51 1 77 3 rpsP Small ribosomal subunit protein bS16 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B0TH64 9.4e-19 76 49 1 75 3 rpsP Small ribosomal subunit protein bS16 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
B7J2Q0 9.44e-19 75 45 1 74 3 rpsP Small ribosomal subunit protein bS16 Borreliella burgdorferi (strain ZS7)
O51638 9.44e-19 75 45 1 74 1 rpsP Small ribosomal subunit protein bS16 Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
B1LB75 9.62e-19 76 45 1 77 3 rpsP Small ribosomal subunit protein bS16 Thermotoga sp. (strain RQ2)
A5IM17 9.62e-19 76 45 1 77 3 rpsP Small ribosomal subunit protein bS16 Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
Q9X1Q2 9.62e-19 76 45 1 77 3 rpsP Small ribosomal subunit protein bS16 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
A4J669 9.67e-19 75 45 1 77 3 rpsP Small ribosomal subunit protein bS16 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q18BB8 1.05e-18 75 45 1 74 3 rpsP Small ribosomal subunit protein bS16 Clostridioides difficile (strain 630)
Q04FP8 1.09e-18 76 46 1 77 3 rpsP Small ribosomal subunit protein bS16 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
P21474 1.1e-18 75 51 1 76 1 rpsP Small ribosomal subunit protein bS16 Bacillus subtilis (strain 168)
A6Q769 1.42e-18 75 48 2 76 3 rpsP Small ribosomal subunit protein bS16 Sulfurovum sp. (strain NBC37-1)
Q3A2E4 1.51e-18 75 50 1 76 3 rpsP Small ribosomal subunit protein bS16 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q24UA5 1.58e-18 75 48 1 75 3 rpsP Small ribosomal subunit protein bS16 Desulfitobacterium hafniense (strain Y51)
B8FRL6 1.58e-18 75 48 1 75 3 rpsP Small ribosomal subunit protein bS16 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
B5YK94 1.61e-18 75 48 1 76 3 rpsP Small ribosomal subunit protein bS16 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q03JG3 1.77e-18 75 50 1 74 3 rpsP Small ribosomal subunit protein bS16 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M387 1.77e-18 75 50 1 74 3 rpsP Small ribosomal subunit protein bS16 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LYM4 1.77e-18 75 50 1 74 3 rpsP Small ribosomal subunit protein bS16 Streptococcus thermophilus (strain CNRZ 1066)
Q5SJH3 1.84e-18 75 43 1 78 1 rpsP Small ribosomal subunit protein bS16 Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
P62238 1.84e-18 75 43 1 78 1 rpsP Small ribosomal subunit protein bS16 Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q03FW5 1.93e-18 75 48 1 77 3 rpsP Small ribosomal subunit protein bS16 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
B7IUK3 1.93e-18 75 51 1 74 3 rpsP Small ribosomal subunit protein bS16 Bacillus cereus (strain G9842)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS01860
Feature type CDS
Gene rpsP
Product 30S ribosomal protein S16
Location 438017 - 438265 (strand: 1)
Length 249 (nucleotides) / 82 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2041
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00886 Ribosomal protein S16

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0228 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein S16

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02959 small subunit ribosomal protein S16 Ribosome -

Protein Sequence

MVTIRLARGGAKKRPFYQVVVTDSRNARDGRFIERVGFYNPLATGNAEELRLDVDRVEHWVAQGATVSERVAGLIKSAKKSA

Flanking regions ( +/- flanking 50bp)

ACGCCATTCCTCGATGGGGTCTGGTTGTTTTGTTAACTAATGAGGATGTTATGGTAACAATTCGTTTAGCTCGTGGCGGCGCAAAAAAGCGTCCGTTTTACCAAGTAGTCGTGACCGATAGCCGCAATGCGCGTGATGGTCGTTTTATTGAACGTGTAGGTTTTTATAACCCACTGGCAACCGGTAATGCAGAAGAATTACGTTTAGACGTAGACCGTGTTGAACATTGGGTTGCTCAAGGCGCAACTGTTTCAGAACGTGTTGCTGGCCTGATCAAATCAGCGAAGAAAAGCGCTTAATCTGTCGCGGTGGTAACAATGAGCGAACAAAAAACCTTTAAAGAGCCTGT