Homologs in group_2055

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15140 FBDBKF_15140 76.2 Morganella morganii S1 nqrC Na(+)-translocating NADH-quinone reductase subunit C
EHELCC_11105 EHELCC_11105 76.2 Morganella morganii S2 nqrC Na(+)-translocating NADH-quinone reductase subunit C
NLDBIP_11450 NLDBIP_11450 76.2 Morganella morganii S4 nqrC Na(+)-translocating NADH-quinone reductase subunit C
LHKJJB_11310 LHKJJB_11310 76.2 Morganella morganii S3 nqrC Na(+)-translocating NADH-quinone reductase subunit C
HKOGLL_09920 HKOGLL_09920 76.2 Morganella morganii S5 nqrC Na(+)-translocating NADH-quinone reductase subunit C
F4V73_RS12305 F4V73_RS12305 74.3 Morganella psychrotolerans - Na(+)-translocating NADH-quinone reductase subunit C

Distribution of the homologs in the orthogroup group_2055

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2055

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8ZBZ2 5.49e-111 323 62 2 259 3 nqrC Na(+)-translocating NADH-quinone reductase subunit C Yersinia pestis
Q56582 1.68e-96 286 55 4 257 1 nqrC Na(+)-translocating NADH-quinone reductase subunit C Vibrio alginolyticus
Q9CLA9 2.51e-95 283 52 0 256 3 nqrC Na(+)-translocating NADH-quinone reductase subunit C Pasteurella multocida (strain Pm70)
P0C6E0 3.79e-94 280 53 4 257 1 nqrC Na(+)-translocating NADH-quinone reductase subunit C Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F5Y7 3.79e-94 280 53 4 257 1 nqrC Na(+)-translocating NADH-quinone reductase subunit C Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q87MA8 1.46e-89 268 52 4 262 3 nqrC Na(+)-translocating NADH-quinone reductase subunit C Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q75R62 2.86e-88 265 52 4 257 3 nqrC Na(+)-translocating NADH-quinone reductase subunit C Vibrio anguillarum
Q7MIC9 9.71e-87 261 51 4 257 3 nqrC Na(+)-translocating NADH-quinone reductase subunit C Vibrio vulnificus (strain YJ016)
Q8DBJ4 9.71e-87 261 51 4 257 3 nqrC Na(+)-translocating NADH-quinone reductase subunit C Vibrio vulnificus (strain CMCP6)
P43957 1.13e-86 261 53 2 252 3 nqrC Na(+)-translocating NADH-quinone reductase subunit C Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9RFV9 8.78e-85 256 51 4 262 1 nqrC Na(+)-translocating NADH-quinone reductase subunit C Vibrio campbellii (strain ATCC BAA-1116)
Q7VNU7 3.03e-82 250 49 1 250 3 nqrC Na(+)-translocating NADH-quinone reductase subunit C Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q9JVQ0 5.97e-77 236 46 2 256 3 nqrC Na(+)-translocating NADH-quinone reductase subunit C Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9K0M5 1e-75 233 46 2 256 3 nqrC Na(+)-translocating NADH-quinone reductase subunit C Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9HZK8 4.61e-70 219 47 3 259 3 nqrC Na(+)-translocating NADH-quinone reductase subunit C Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
O84281 5.03e-23 99 27 9 283 3 nqrC Na(+)-translocating NADH-quinone reductase subunit C Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q9PKB5 6.84e-22 95 27 9 282 3 nqrC Na(+)-translocating NADH-quinone reductase subunit C Chlamydia muridarum (strain MoPn / Nigg)
Q9Z8B5 3.41e-18 85 29 9 230 3 nqrC Na(+)-translocating NADH-quinone reductase subunit C Chlamydia pneumoniae
Q823P3 5.86e-17 82 25 8 293 3 nqrC Na(+)-translocating NADH-quinone reductase subunit C Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS01695
Feature type CDS
Gene -
Product Na(+)-translocating NADH-quinone reductase subunit C
Location 404399 - 405184 (strand: 1)
Length 786 (nucleotides) / 261 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2055
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04205 FMN-binding domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2869 Energy production and conversion (C) C Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrC

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00348 Na+-transporting NADH:ubiquinone oxidoreductase subunit C [EC:7.2.1.1] - -

Protein Sequence

MAKEKNKDSVGRTFLVVFILCLVCSVVVAGSAVGLKSKQEEQKLLDKQRNILDVAGLLVPKMSASEVLKVYDTRIKAKIVNFKTGELTDSKGDFDLNSELRSDETSIALSPEEDIAKIRRRANTAEVYFVLDDQGKTQEVVLPVYGSGLWSVMYAFVAVDIDGVTAKGITYYSHGETPGLGGEVDNPQWKAQWKGKRLLNEEGVPAIKIVRGGASDSPYGIDGLSGATLTSNGVQHMFDFWLGDKGFGPFLKKVREGEING

Flanking regions ( +/- flanking 50bp)

GCTGTTTGACTATGTGGTTGTTCAGGCGAATATTAAGCGGAGAAAAGCTCGTGGCTAAAGAAAAAAACAAAGATAGCGTCGGAAGAACGTTCCTCGTTGTATTTATTCTATGTCTTGTTTGTTCCGTGGTAGTGGCTGGCTCTGCTGTTGGACTTAAATCTAAGCAAGAAGAGCAAAAGCTACTGGATAAACAACGTAATATTCTAGATGTTGCTGGTTTATTGGTGCCTAAAATGAGCGCCAGTGAAGTACTCAAAGTTTACGATACACGCATTAAAGCTAAGATTGTAAACTTCAAAACTGGCGAATTGACAGACAGTAAAGGCGACTTTGATTTAAATAGCGAACTACGTAGCGATGAAACCTCTATCGCACTATCACCTGAAGAAGATATTGCAAAAATTCGTCGTCGTGCCAATACCGCAGAAGTTTACTTTGTTCTTGATGATCAAGGTAAAACCCAAGAAGTGGTACTGCCCGTCTATGGTTCAGGCCTATGGTCGGTCATGTATGCCTTTGTTGCGGTAGATATTGATGGTGTAACAGCGAAGGGGATTACCTATTATTCTCATGGTGAAACGCCGGGGCTAGGTGGAGAAGTTGATAATCCGCAATGGAAGGCACAGTGGAAAGGTAAACGCTTACTGAATGAAGAAGGTGTGCCTGCTATTAAAATCGTACGTGGCGGGGCATCAGATAGTCCTTATGGTATTGATGGCCTTTCAGGTGCAACCTTAACCTCTAACGGCGTTCAACATATGTTCGATTTTTGGTTAGGTGATAAAGGTTTCGGCCCATTCCTGAAAAAAGTTCGTGAAGGAGAGATCAATGGCTGATACAAAAGAGATCAAACGCGTTTTACTCGGGCCGTTGTTAGATAATAACC