Homologs in group_2040

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15055 FBDBKF_15055 59.3 Morganella morganii S1 algH YqgE/AlgH family protein
EHELCC_11190 EHELCC_11190 59.3 Morganella morganii S2 algH YqgE/AlgH family protein
NLDBIP_11535 NLDBIP_11535 59.3 Morganella morganii S4 algH YqgE/AlgH family protein
LHKJJB_11395 LHKJJB_11395 59.3 Morganella morganii S3 algH YqgE/AlgH family protein
HKOGLL_10005 HKOGLL_10005 59.3 Morganella morganii S5 algH YqgE/AlgH family protein
F4V73_RS12395 F4V73_RS12395 60.4 Morganella psychrotolerans - YqgE/AlgH family protein

Distribution of the homologs in the orthogroup group_2040

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2040

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EUS1 1.95e-136 381 100 0 187 3 PMI0339 UPF0301 protein PMI0339 Proteus mirabilis (strain HI4320)
Q7N7G6 9.97e-103 296 72 0 187 3 plu1183 UPF0301 protein plu1183 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q2NRC7 7.25e-93 271 66 0 187 3 SG2023 UPF0301 protein SG2023 Sodalis glossinidius (strain morsitans)
A7MJR9 2.14e-92 270 67 0 187 3 ESA_00394 UPF0301 protein ESA_00394 Cronobacter sakazakii (strain ATCC BAA-894)
Q5PJJ8 1.63e-91 268 65 0 187 3 yqgE UPF0301 protein YqgE Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A8GJ32 2.03e-91 268 66 0 187 3 Spro_4027 UPF0301 protein Spro_4027 Serratia proteamaculans (strain 568)
B7LPR5 2.88e-91 267 65 0 187 3 yqgE UPF0301 protein YqgE Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q31WL0 5.26e-91 266 64 0 187 3 yqgE UPF0301 protein YqgE Shigella boydii serotype 4 (strain Sb227)
Q3YXS3 5.99e-91 266 64 0 187 3 yqgE UPF0301 protein YqgE Shigella sonnei (strain Ss046)
P0A8W7 5.99e-91 266 64 0 187 3 yqgE UPF0301 protein YqgE Shigella flexneri
Q32C17 5.99e-91 266 64 0 187 3 yqgE UPF0301 protein YqgE Shigella dysenteriae serotype 1 (strain Sd197)
B2U0W8 5.99e-91 266 64 0 187 3 yqgE UPF0301 protein YqgE Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q1R779 5.99e-91 266 64 0 187 3 yqgE UPF0301 protein YqgE Escherichia coli (strain UTI89 / UPEC)
B6I786 5.99e-91 266 64 0 187 3 yqgE UPF0301 protein YqgE Escherichia coli (strain SE11)
B7N7K1 5.99e-91 266 64 0 187 3 yqgE UPF0301 protein YqgE Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A8W5 5.99e-91 266 64 0 187 1 yqgE UPF0301 protein YqgE Escherichia coli (strain K12)
P0A8W6 5.99e-91 266 64 0 187 3 yqgE UPF0301 protein YqgE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TDQ3 5.99e-91 266 64 0 187 3 yqgE UPF0301 protein YqgE Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AFD4 5.99e-91 266 64 0 187 3 yqgE UPF0301 protein YqgE Escherichia coli O1:K1 / APEC
A8A488 5.99e-91 266 64 0 187 3 yqgE UPF0301 protein YqgE Escherichia coli O9:H4 (strain HS)
B1XFA8 5.99e-91 266 64 0 187 3 yqgE UPF0301 protein YqgE Escherichia coli (strain K12 / DH10B)
C5A0L7 5.99e-91 266 64 0 187 3 yqgE UPF0301 protein YqgE Escherichia coli (strain K12 / MC4100 / BW2952)
B7LYX8 5.99e-91 266 64 0 187 3 yqgE UPF0301 protein YqgE Escherichia coli O8 (strain IAI1)
B7MZP7 5.99e-91 266 64 0 187 3 yqgE UPF0301 protein YqgE Escherichia coli O81 (strain ED1a)
B5YQE6 5.99e-91 266 64 0 187 3 yqgE UPF0301 protein YqgE Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XCW1 5.99e-91 266 64 0 187 3 yqgE UPF0301 protein YqgE Escherichia coli O157:H7
B7LFL1 5.99e-91 266 64 0 187 3 yqgE UPF0301 protein YqgE Escherichia coli (strain 55989 / EAEC)
B7MMD6 5.99e-91 266 64 0 187 3 yqgE UPF0301 protein YqgE Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZR71 5.99e-91 266 64 0 187 3 yqgE UPF0301 protein YqgE Escherichia coli O139:H28 (strain E24377A / ETEC)
B7UHZ5 8.42e-91 266 64 0 187 3 yqgE UPF0301 protein YqgE Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B5BFQ3 1e-90 266 65 0 187 3 yqgE UPF0301 protein YqgE Salmonella paratyphi A (strain AKU_12601)
Q8Z3V2 1.07e-90 266 65 0 187 3 yqgE UPF0301 protein YqgE Salmonella typhi
B4T5K3 1.07e-90 266 65 0 187 3 yqgE UPF0301 protein YqgE Salmonella newport (strain SL254)
B4THI1 1.07e-90 266 65 0 187 3 yqgE UPF0301 protein YqgE Salmonella heidelberg (strain SL476)
B1LDF7 1.24e-90 265 64 0 187 3 yqgE UPF0301 protein YqgE Escherichia coli (strain SMS-3-5 / SECEC)
B7NI11 1.24e-90 265 64 0 187 3 yqgE UPF0301 protein YqgE Escherichia coli O7:K1 (strain IAI39 / ExPEC)
Q8ZM51 1.83e-90 265 65 0 187 3 yqgE UPF0301 protein YqgE Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4TV65 1.83e-90 265 65 0 187 3 yqgE UPF0301 protein YqgE Salmonella schwarzengrund (strain CVM19633)
C0PY73 1.83e-90 265 65 0 187 3 yqgE UPF0301 protein YqgE Salmonella paratyphi C (strain RKS4594)
Q57K20 1.83e-90 265 65 0 187 3 yqgE UPF0301 protein YqgE Salmonella choleraesuis (strain SC-B67)
Q6D076 2e-90 265 66 0 187 3 ECA3925 UPF0301 protein ECA3925 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C6DFI8 2.49e-90 265 66 0 187 3 PC1_3712 UPF0301 protein PC1_3712 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A6TDV7 3e-90 265 65 0 187 3 KPN78578_33170 UPF0301 protein KPN78578_33170 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XUA2 4.12e-90 264 65 0 187 3 KPK_0728 UPF0301 protein KPK_0728 Klebsiella pneumoniae (strain 342)
A9N4P2 4.6e-90 264 65 0 187 3 yqgE UPF0301 protein YqgE Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B5RE56 6.75e-90 264 64 0 187 3 yqgE UPF0301 protein YqgE Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QY72 6.75e-90 264 64 0 187 3 yqgE UPF0301 protein YqgE Salmonella enteritidis PT4 (strain P125109)
B5FUV9 6.75e-90 264 64 0 187 3 yqgE UPF0301 protein YqgE Salmonella dublin (strain CT_02021853)
B5F5M1 6.75e-90 264 64 0 187 3 yqgE UPF0301 protein YqgE Salmonella agona (strain SL483)
B1JNP6 3.05e-88 259 64 0 187 3 YPK_0837 UPF0301 protein YPK_0837 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A7FEZ1 3.05e-88 259 64 0 187 3 YpsIP31758_0835 UPF0301 protein YpsIP31758_0835 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B2K0T3 3.05e-88 259 64 0 187 3 YPTS_3341 UPF0301 protein YPTS_3341 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q666P0 3.05e-88 259 64 0 187 3 YPTB3208 UPF0301 protein YPTB3208 Yersinia pseudotuberculosis serotype I (strain IP32953)
Q8ZHG3 5.45e-88 259 64 0 187 3 YPO0936 UPF0301 protein YPO0936/y3322/YP_3506 Yersinia pestis
A4TI77 5.45e-88 259 64 0 187 3 YPDSF_0579 UPF0301 protein YPDSF_0579 Yersinia pestis (strain Pestoides F)
A9R308 5.45e-88 259 64 0 187 3 YpAngola_A3341 UPF0301 protein YpAngola_A3341 Yersinia pestis bv. Antiqua (strain Angola)
Q1CB75 5.45e-88 259 64 0 187 3 YPA_0329 UPF0301 protein YPA_0329 Yersinia pestis bv. Antiqua (strain Antiqua)
Q1CEX0 5.45e-88 259 64 0 187 3 YPN_3133 UPF0301 protein YPN_3133 Yersinia pestis bv. Antiqua (strain Nepal516)
B2VF12 1.31e-87 258 62 0 187 3 ETA_28320 UPF0301 protein ETA_28320 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A1JPT5 3.92e-87 256 63 0 187 3 YE3428 UPF0301 protein YE3428 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8APG7 3.07e-83 247 65 0 187 3 CKO_04323 UPF0301 protein CKO_04323 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q7VRG6 1.74e-82 245 57 0 186 3 Bfl251 UPF0301 protein Bfl251 Blochmanniella floridana
Q493F3 3.75e-82 244 57 0 187 3 BPEN_258 UPF0301 protein BPEN_258 Blochmanniella pennsylvanica (strain BPEN)
C4K450 2.09e-77 232 56 1 187 3 HDEF_0602 UPF0301 protein HDEF_0602 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q87LK0 7.99e-76 228 56 2 188 3 VP2612 UPF0301 protein VP2612 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q1LSZ6 2.75e-75 227 57 0 187 3 BCI_0481 UPF0301 protein BCI_0481 Baumannia cicadellinicola subsp. Homalodisca coagulata
B7VKQ2 1.3e-74 225 55 2 188 3 VS_2679 UPF0301 protein VS_2679 Vibrio atlanticus (strain LGP32)
Q3IFA1 9.42e-74 223 55 3 187 3 PSHAa2600 UPF0301 protein PSHAa2600 Pseudoalteromonas translucida (strain TAC 125)
B5F9S7 3e-73 221 53 3 191 3 VFMJ11_0434 UPF0301 protein VFMJ11_0434 Aliivibrio fischeri (strain MJ11)
Q5E7R7 3e-73 221 53 3 191 3 VF_0434 UPF0301 protein VF_0434 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q7MHK0 3.21e-73 221 55 2 188 3 VV2869 UPF0301 protein VV2869 Vibrio vulnificus (strain YJ016)
Q8DCB0 3.21e-73 221 55 2 188 3 VV1_1529 UPF0301 protein VV1_1529 Vibrio vulnificus (strain CMCP6)
Q9KUP8 1.06e-72 220 54 2 188 1 VC_0467 UPF0301 protein VC_0467 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q6LMM3 2.29e-70 214 55 3 191 3 PBPRA3139 UPF0301 protein PBPRA3139 Photobacterium profundum (strain SS9)
B6EMV3 5.01e-69 211 51 3 191 3 VSAL_I0547 UPF0301 protein VSAL_I0547 Aliivibrio salmonicida (strain LFI1238)
Q8D336 1.3e-67 207 50 0 187 3 WIGBR1650 UPF0301 protein WIGBR1650 Wigglesworthia glossinidia brevipalpis
Q5QVM4 2.45e-67 206 50 2 185 3 IL2218 UPF0301 protein IL2218 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B1KIY1 7.73e-63 195 49 2 185 3 Swoo_1337 UPF0301 protein Swoo_1337 Shewanella woodyi (strain ATCC 51908 / MS32)
Q0HX86 1.62e-62 194 47 1 186 3 Shewmr7_1270 UPF0301 protein Shewmr7_1270 Shewanella sp. (strain MR-7)
A0KUG6 1.62e-62 194 47 1 186 3 Shewana3_1200 UPF0301 protein Shewana3_1200 Shewanella sp. (strain ANA-3)
Q0HKY8 1.62e-62 194 47 1 186 3 Shewmr4_1199 UPF0301 protein Shewmr4_1199 Shewanella sp. (strain MR-4)
Q07Z75 3.03e-62 194 47 2 186 3 Sfri_2850 UPF0301 protein Sfri_2850 Shewanella frigidimarina (strain NCIMB 400)
C5CL71 3.06e-62 194 50 3 196 3 Vapar_4617 UPF0301 protein Vapar_4617 Variovorax paradoxus (strain S110)
B8CQG1 5.52e-62 193 50 2 186 3 swp_3600 UPF0301 protein swp_3600 Shewanella piezotolerans (strain WP3 / JCM 13877)
A9KXN7 1.11e-61 192 47 1 186 3 Sbal195_3177 UPF0301 protein Sbal195_3177 Shewanella baltica (strain OS195)
B8E9P8 1.11e-61 192 47 1 186 3 Sbal223_1344 UPF0301 protein Sbal223_1344 Shewanella baltica (strain OS223)
A3QC17 1.65e-61 192 49 2 185 3 Shew_1144 UPF0301 protein Shew_1144 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A1WI20 1.11e-60 190 47 3 197 3 Veis_1517 UPF0301 protein Veis_1517 Verminephrobacter eiseniae (strain EF01-2)
Q486M0 1.14e-60 190 45 2 208 3 CPS_1252 UPF0301 protein CPS_1252 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A8FSM5 2.41e-60 189 47 2 186 3 Ssed_1237 UPF0301 protein Ssed_1237 Shewanella sediminis (strain HAW-EB3)
Q8EBZ9 3.94e-60 188 45 1 186 1 SO_3346 UPF0301 protein SO_3346 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A4Y8W7 4.69e-60 188 47 1 186 3 Sputcn32_2681 UPF0301 protein Sputcn32_2681 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A1RHM8 4.69e-60 188 47 1 186 3 Sputw3181_1330 UPF0301 protein Sputw3181_1330 Shewanella sp. (strain W3-18-1)
Q7NR75 9.55e-60 187 47 2 187 3 CV_3909 UPF0301 protein CV_3909 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
B8GP63 1.65e-59 187 47 2 186 3 Tgr7_2910 UPF0301 protein Tgr7_2910 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q89A51 1.81e-59 187 46 2 188 3 bbp_491 UPF0301 protein bbp_491 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q474U6 8.43e-59 185 49 2 187 3 Reut_A0705 UPF0301 protein Reut_A0705 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q1LJR0 1.38e-58 184 48 2 187 3 Rmet_2743 UPF0301 protein Rmet_2743 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q2Y654 1.51e-58 184 43 2 187 3 Nmul_A2478 UPF0301 protein Nmul_A2478 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A1WBR0 5.5e-58 183 48 4 196 3 Ajs_3573 UPF0301 protein Ajs_3573 Acidovorax sp. (strain JS42)
B9MF60 5.5e-58 183 48 4 196 3 Dtpsy_2896 UPF0301 protein Dtpsy_2896 Acidovorax ebreus (strain TPSY)
A1TKL7 6.61e-58 183 46 5 210 3 Aave_0907 UPF0301 protein Aave_0907 Paracidovorax citrulli (strain AAC00-1)
Q21EI7 7.5e-58 183 44 2 187 3 Sde_3637 UPF0301 protein Sde_3637 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q12EE9 9.86e-58 182 49 4 192 3 Bpro_1142 UPF0301 protein Bpro_1142 Polaromonas sp. (strain JS666 / ATCC BAA-500)
A9AFI7 2.24e-57 181 48 3 189 3 Bmul_2524 UPF0301 protein Bmul_2524/BMULJ_00714 Burkholderia multivorans (strain ATCC 17616 / 249)
A0K540 3.67e-57 181 47 3 189 3 Bcen2424_0864 UPF0301 protein Bcen2424_0864 Burkholderia cenocepacia (strain HI2424)
B1JWN9 3.67e-57 181 47 3 189 3 Bcenmc03_0835 UPF0301 protein Bcenmc03_0835 Burkholderia orbicola (strain MC0-3)
Q1BYL1 3.67e-57 181 47 3 189 3 Bcen_0382 UPF0301 protein Bcen_0382 Burkholderia orbicola (strain AU 1054)
Q8Y1L5 5.75e-57 180 46 2 187 3 RSc0675 UPF0301 protein RSc0675 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B4ECT3 6.19e-57 180 47 3 189 3 BceJ2315_30870 UPF0301 protein BceJ2315_30870 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q39J05 6.98e-57 180 47 3 189 3 Bcep18194_A3962 UPF0301 protein Bcep18194_A3962 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q605E8 7.17e-57 180 44 2 185 3 MCA2336 UPF0301 protein MCA2336 2 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A4JC07 7.29e-57 180 48 3 189 3 Bcep1808_0798 UPF0301 protein Bcep1808_0798 Burkholderia vietnamiensis (strain G4 / LMG 22486)
B1YU27 8.04e-57 180 47 3 189 3 BamMC406_0754 UPF0301 protein BamMC406_0754 Burkholderia ambifaria (strain MC40-6)
Q0BHS7 8.04e-57 180 47 3 189 3 Bamb_0737 UPF0301 protein Bamb_0737 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q21YP2 1.08e-56 180 49 3 195 3 Rfer_1377 UPF0301 protein Rfer_1377 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q478W0 1.34e-56 179 45 2 187 3 Daro_3893 UPF0301 protein Daro_3893 Dechloromonas aromatica (strain RCB)
Q3JE52 1.35e-56 179 40 2 183 3 Noc_0368 UPF0301 protein Noc_0368 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A2S9S9 2.76e-56 179 47 3 189 3 BMA10229_A2746 UPF0301 protein BMA10229_A2746 Burkholderia mallei (strain NCTC 10229)
A3MMB0 2.76e-56 179 47 3 189 3 BMA10247_1859 UPF0301 protein BMA10247_1859 Burkholderia mallei (strain NCTC 10247)
Q3JPG1 2.76e-56 179 47 3 189 3 BURPS1710b_3170 UPF0301 protein BURPS1710b_3170 Burkholderia pseudomallei (strain 1710b)
A3NYG5 2.76e-56 179 47 3 189 3 BURPS1106A_3148 UPF0301 protein BURPS1106A_3148 Burkholderia pseudomallei (strain 1106a)
A3NCQ3 2.76e-56 179 47 3 189 3 BURPS668_3112 UPF0301 protein BURPS668_3112 Burkholderia pseudomallei (strain 668)
A1V203 2.76e-56 179 47 3 189 3 BMASAVP1_A0916 UPF0301 protein BMASAVP1_A0916 Burkholderia mallei (strain SAVP1)
Q63RH9 2.76e-56 179 47 3 189 3 BPSL2693 UPF0301 protein BPSL2693 Burkholderia pseudomallei (strain K96243)
Q62I86 2.76e-56 179 47 3 189 3 BMA1997 UPF0301 protein BMA1997 Burkholderia mallei (strain ATCC 23344)
Q3SFS4 3.24e-56 178 45 3 194 3 Tbd_2579 UPF0301 protein Tbd_2579 Thiobacillus denitrificans (strain ATCC 25259)
Q2SYJ1 3.43e-56 178 47 3 189 3 BTH_I1462 UPF0301 protein BTH_I1462 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2SPH0 5.36e-56 177 47 2 185 3 HCH_00550 UPF0301 protein HCH_00550 Hahella chejuensis (strain KCTC 2396)
A9BY83 9.55e-56 177 45 3 196 3 Daci_1578 UPF0301 protein Daci_1578 Delftia acidovorans (strain DSM 14801 / SPH-1)
A1KB69 1.18e-55 177 42 3 187 3 azo3459 UPF0301 protein azo3459 Azoarcus sp. (strain BH72)
B2T0I4 1.41e-55 177 46 3 189 3 Bphyt_0868 UPF0301 protein Bphyt_0868 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q144Q2 1.41e-55 177 46 3 189 3 Bxeno_A0649 UPF0301 protein Bxeno_A0649 Paraburkholderia xenovorans (strain LB400)
C1D4R8 4.79e-55 175 43 2 187 3 LHK_02881 UPF0301 protein LHK_02881 Laribacter hongkongensis (strain HLHK9)
Q5P6I7 4.99e-55 175 43 3 187 3 AZOSEA09490 UPF0301 protein AZOSEA09490 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q9CJX1 8.73e-55 174 47 4 189 3 PM1869 UPF0301 protein PM1869 Pasteurella multocida (strain Pm70)
Q12KS3 8.75e-55 174 43 2 186 3 Sden_2674 UPF0301 protein Sden_2674 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q5F935 9.07e-55 174 46 3 189 3 NGO0569 UPF0301 protein NGO0569 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
B4RMJ5 9.07e-55 174 46 3 189 3 NGK_1355 UPF0301 protein NGK_1355 Neisseria gonorrhoeae (strain NCCP11945)
Q9JZ17 1.07e-54 174 46 3 189 3 NMB1336 UPF0301 protein NMB1336 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A1KUG1 2.47e-54 173 46 3 189 3 NMC1274 UPF0301 protein NMC1274 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q0I1B4 3.92e-54 173 49 3 177 3 HS_0009 UPF0301 protein HS_0009 Histophilus somni (strain 129Pt)
A9LZR4 4.92e-54 172 45 3 189 3 NMCC_1249 UPF0301 protein NMCC_1249 Neisseria meningitidis serogroup C (strain 053442)
Q9JU12 5.08e-54 172 46 3 189 3 NMA1550 UPF0301 protein NMA1550 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q82U41 7.98e-54 172 43 2 187 3 NE1668 UPF0301 protein NE1668 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q5X7G9 8.14e-54 172 42 3 189 3 lpp0636 UPF0301 protein lpp0636 Legionella pneumophila (strain Paris)
Q5ZXZ4 8.14e-54 172 42 3 189 3 lpg0586 UPF0301 protein lpg0586 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IGX8 8.14e-54 172 42 3 189 3 LPC_2717 UPF0301 protein LPC_2717 Legionella pneumophila (strain Corby)
Q8P765 1.71e-53 171 42 2 185 3 XCC2748 UPF0301 protein XCC2748 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RQM8 1.71e-53 171 42 2 185 3 xcc-b100_1413 UPF0301 protein xcc-b100_1413 Xanthomonas campestris pv. campestris (strain B100)
Q4UWY9 1.71e-53 171 42 2 185 3 XC_1365 UPF0301 protein XC_1365 Xanthomonas campestris pv. campestris (strain 8004)
B2U7A8 1.85e-53 171 45 2 187 3 Rpic_0619 UPF0301 protein Rpic_0619 Ralstonia pickettii (strain 12J)
Q0AIU6 1.97e-53 171 44 3 187 3 Neut_0448 UPF0301 protein Neut_0448 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
B0UWW1 3.75e-53 171 49 3 177 3 HSM_1900 UPF0301 protein HSM_1900 Histophilus somni (strain 2336)
B2JFD4 6.62e-53 170 44 3 188 3 Bphy_2327 UPF0301 protein Bphy_2327 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q5WYW5 8.48e-53 169 42 3 189 3 lpl0620 UPF0301 protein lpl0620 Legionella pneumophila (strain Lens)
Q65VZ3 4.32e-52 168 45 3 188 3 MS0260 UPF0301 protein MS0260 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q5LX84 4.57e-52 167 45 3 188 3 SPO0296 UPF0301 protein SPO0296 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q1GZH1 4.57e-52 168 41 4 191 3 Mfla_2099 UPF0301 protein Mfla_2099 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
B2FRV1 6.5e-52 167 41 3 186 3 Smlt1098 UPF0301 protein Smlt1098 Stenotrophomonas maltophilia (strain K279a)
A9I1S7 1.94e-51 167 46 3 183 3 Bpet0561 UPF0301 protein Bpet0561 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q3BR19 5.68e-51 165 42 2 185 3 XCV3063 UPF0301 protein XCV3063 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q0VTI3 7.53e-51 165 40 2 185 3 ABO_0112 UPF0301 protein ABO_0112 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
B4SMG8 9.37e-51 164 41 3 186 3 Smal_0940 UPF0301 protein Smal_0940 Stenotrophomonas maltophilia (strain R551-3)
B2SIZ5 9.89e-51 164 42 2 185 3 PXO_02000 UPF0301 protein PXO_02000 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q5H2Z2 9.89e-51 164 42 2 185 3 XOO1425 UPF0301 protein XOO1425 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P5W3 9.89e-51 164 42 2 185 3 XOO1309 UPF0301 protein XOO1309 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q163D2 1.02e-50 164 43 2 188 3 RD1_3419 UPF0301 protein RD1_3419 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q8PIH9 3.58e-50 163 41 2 185 3 XAC2918 UPF0301 protein XAC2918 Xanthomonas axonopodis pv. citri (strain 306)
Q1R1I6 4.1e-50 162 41 3 187 3 Csal_0058 UPF0301 protein Csal_0058 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q4QNN9 2.07e-49 161 46 6 189 3 NTHI0415 UPF0301 protein NTHI0415 Haemophilus influenzae (strain 86-028NP)
Q1QEQ7 2.14e-49 161 40 1 186 3 Pcryo_0062 UPF0301 protein Pcryo_0062 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
A6UYL5 2.27e-49 161 43 4 187 3 PSPA7_0505 UPF0301 protein PSPA7_0505 Pseudomonas aeruginosa (strain PA7)
A9NBU1 2.47e-49 160 42 3 185 3 COXBURSA331_A2219 UPF0301 protein COXBURSA331_A2219 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KDE7 2.47e-49 160 42 3 185 3 CBUD_2193 UPF0301 protein CBUD_2193 Coxiella burnetii (strain Dugway 5J108-111)
Q83A18 3.7e-49 160 42 3 185 3 CBU_2093 UPF0301 protein CBU_2093 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A5UAI5 4.16e-49 160 46 6 189 3 CGSHiEE_01530 UPF0301 protein CGSHiEE_01530 Haemophilus influenzae (strain PittEE)
Q2KUT1 4.42e-49 160 42 3 183 3 BAV3012 UPF0301 protein BAV3012 Bordetella avium (strain 197N)
P43980 5.77e-49 160 45 6 189 3 HI_0304 UPF0301 protein HI_0304 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q02U07 6.39e-49 160 43 4 187 3 PA14_05290 UPF0301 protein PA14_05290 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V3Z2 1.41e-48 159 43 4 187 3 PLES_04031 UPF0301 protein PLES_04031 Pseudomonas aeruginosa (strain LESB58)
Q9RQ16 1.41e-48 159 43 4 187 1 algH UPF0301 protein AlgH Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q4FVM7 3.47e-48 158 40 1 186 3 Psyc_0057 UPF0301 protein Psyc_0057 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A3PN45 3.57e-48 158 43 3 190 3 Rsph17029_2659 UPF0301 protein Rsph17029_2659 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q3IZ52 5.52e-48 157 42 3 190 3 RHOS4_26140 UPF0301 protein RHOS4_26140 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
B2I5Z0 5.65e-48 157 40 2 187 3 XfasM23_1361 UPF0301 protein XfasM23_1361 Xylella fastidiosa (strain M23)
Q87C20 5.65e-48 157 40 2 187 3 PD_1276 UPF0301 protein PD_1276 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0BSN9 7.61e-48 157 44 3 175 3 APJL_0237 UPF0301 protein APJL_0237 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H074 7.61e-48 157 44 3 175 3 APP7_0234 UPF0301 protein APP7_0234 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3MYV4 7.61e-48 157 44 3 175 3 APL_0232 UPF0301 protein APL_0232 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q88D33 1.07e-47 157 40 3 185 3 PP_4995 UPF0301 protein PP_4995 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A5WA29 1.07e-47 157 40 3 185 3 Pput_4869 UPF0301 protein Pput_4869 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B9KNE5 1.19e-47 156 42 3 190 3 RSKD131_2391 UPF0301 protein RSKD131_2391 Cereibacter sphaeroides (strain KD131 / KCTC 12085)
A4VRH8 1.55e-47 156 40 3 185 3 PST_3956 UPF0301 protein PST_3956 Stutzerimonas stutzeri (strain A1501)
Q28KE9 1.57e-47 156 40 3 188 3 Jann_3896 UPF0301 protein Jann_3896 Jannaschia sp. (strain CCS1)
Q1I3U5 1.78e-47 156 41 3 185 3 PSEEN5058 UPF0301 protein PSEEN5058 Pseudomonas entomophila (strain L48)
B8FL92 2.42e-47 155 38 1 186 3 Dalk_3037 UPF0301 protein Dalk_3037 Desulfatibacillum aliphaticivorans
Q9PBB6 2.65e-47 155 40 2 187 3 XF_2228 UPF0301 protein XF_2228 Xylella fastidiosa (strain 9a5c)
B0U3C2 4.23e-47 155 40 2 187 3 Xfasm12_1428 UPF0301 protein Xfasm12_1428 Xylella fastidiosa (strain M12)
A1AZ56 6.71e-47 155 40 2 189 3 Pden_0436 UPF0301 protein Pden_0436 Paracoccus denitrificans (strain Pd 1222)
B0KM20 1.62e-46 154 40 3 185 3 PputGB1_5045 UPF0301 protein PputGB1_5045 Pseudomonas putida (strain GB-1)
Q7VKS7 1.64e-46 154 41 3 175 1 HD_1794 UPF0301 protein HD_1794 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B1J358 5.67e-46 152 39 3 185 3 PputW619_0469 UPF0301 protein PputW619_0469 Pseudomonas putida (strain W619)
Q985V6 8.79e-46 152 41 2 188 3 mlr7511 UPF0301 protein mlr7511 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q31EK4 2.94e-45 150 41 3 185 3 Tcr_1827 UPF0301 protein Tcr_1827 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q48P90 7.35e-45 149 40 3 187 3 PSPPH_0476 UPF0301 protein PSPPH_0476 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q8UHA2 9.31e-45 149 39 3 187 3 Atu0781 UPF0301 protein Atu0781 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q4K4E5 1.03e-44 149 39 4 186 3 PFL_5830 UPF0301 protein PFL_5830 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q3K5A6 1.29e-44 149 39 3 186 3 Pfl01_5311 UPF0301 protein Pfl01_5311 Pseudomonas fluorescens (strain Pf0-1)
B8H5C6 1.76e-44 149 36 4 190 3 CCNA_03506 UPF0301 protein CCNA_03506 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A311 1.76e-44 149 36 4 190 3 CC_3395 UPF0301 protein CC_3395 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q11KC2 1.84e-44 149 40 3 190 3 Meso_0753 UPF0301 protein Meso_0753 Chelativorans sp. (strain BNC1)
B8IHL5 2.1e-44 149 38 3 191 3 Mnod_6933 UPF0301 protein Mnod_6933 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
Q87VA2 5.31e-44 147 39 3 187 3 PSPTO_5037 UPF0301 protein PSPTO_5037 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4ZZ67 7.44e-44 147 39 3 186 3 Psyr_0485 UPF0301 protein Psyr_0485 Pseudomonas syringae pv. syringae (strain B728a)
A5WBR3 8.81e-44 147 41 4 188 3 PsycPRwf_0144 UPF0301 protein PsycPRwf_0144 Psychrobacter sp. (strain PRwf-1)
B0UR82 1.06e-43 147 37 3 191 3 M446_6268 UPF0301 protein M446_6268 Methylobacterium sp. (strain 4-46)
A0L5K4 1.31e-43 146 41 3 178 3 Mmc1_0726 UPF0301 protein Mmc1_0726 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q7WF75 1.88e-43 146 38 3 183 3 BB4405 UPF0301 protein BB4405 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7W3U5 1.88e-43 146 38 3 183 3 BPP3932 UPF0301 protein BPP3932 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7W046 1.88e-43 146 38 3 183 3 BP0319 UPF0301 protein BP0319 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
B8EPL9 4.26e-43 145 36 3 195 3 Msil_1255 UPF0301 protein Msil_1255 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
A5ERQ9 5.25e-43 145 38 5 193 3 BBta_6966 UPF0301 protein BBta_6966 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q1GWT3 5.36e-43 145 36 1 183 3 Sala_0165 UPF0301 protein Sala_0165 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
A6VSP6 9.4e-43 144 38 3 184 3 Mmwyl1_0539 UPF0301 protein Mmwyl1_0539 Marinomonas sp. (strain MWYL1)
Q2RPU1 2.36e-42 143 37 1 185 3 Rru_A3059 UPF0301 protein Rru_A3059 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B9JT47 2.6e-42 143 40 3 190 3 Avi_1069 UPF0301 protein Avi_1069 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
B2IGI6 2.92e-42 143 38 4 193 3 Bind_0718 UPF0301 protein Bind_0718 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q2KBK9 6.19e-42 142 36 2 185 3 RHE_CH00966 UPF0301 protein RHE_CH00966 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B6JJ36 1.16e-41 142 35 3 193 3 OCAR_7326 UPF0301 protein OCAR_7326/OCA5_c07920 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q1QHL8 1.33e-41 142 38 4 193 3 Nham_3550 UPF0301 protein Nham_3550 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
B3PSC4 3.44e-41 140 36 2 186 3 RHECIAT_CH0001061 UPF0301 protein RHECIAT_CH0001061 Rhizobium etli (strain CIAT 652)
B9JAR2 4.36e-41 140 37 3 190 3 Arad_1256 UPF0301 protein Arad_1256 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
C3K3J9 6.6e-41 139 37 4 187 3 PFLU_5755 UPF0301 protein PFLU_5755 Pseudomonas fluorescens (strain SBW25)
Q1MKH3 9.94e-41 139 37 3 188 3 RL1035 UPF0301 protein RL1035 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B5ZSW5 1.75e-40 139 36 3 187 3 Rleg2_0617 UPF0301 protein Rleg2_0617 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
C3MHK7 1.84e-40 139 38 2 188 3 NGR_c05390 UPF0301 protein NGR_c05390 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
C0RHI7 2.53e-40 138 37 3 189 3 BMEA_A0516 UPF0301 protein BMEA_A0516 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M903 2.53e-40 138 37 3 189 3 BCAN_A0487 UPF0301 protein BCAN_A0487 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q8G253 2.53e-40 138 37 3 189 3 BR0480 UPF0301 protein BR0480/BS1330_I0481 Brucella suis biovar 1 (strain 1330)
Q8YFR6 2.53e-40 138 37 3 189 3 BMEI1454 UPF0301 protein BMEI1454 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q2YML2 5.02e-40 137 37 3 189 3 BAB1_0506 UPF0301 protein BAB1_0506 Brucella abortus (strain 2308)
Q57EP1 5.02e-40 137 37 3 189 3 BruAb1_0502 UPF0301 protein BruAb1_0502 Brucella abortus biovar 1 (strain 9-941)
Q89UC5 1.25e-39 137 37 4 193 3 blr1492 UPF0301 protein blr1492 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A5V9R3 1.36e-39 136 33 1 186 3 Swit_2673 UPF0301 protein Swit_2673 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q92RF8 2.32e-39 136 37 3 190 3 R00917 UPF0301 protein R00917 Rhizobium meliloti (strain 1021)
A6U6V8 2.79e-39 135 36 2 188 3 Smed_0532 UPF0301 protein Smed_0532 Sinorhizobium medicae (strain WSM419)
A5VP50 3.76e-39 135 36 3 189 3 BOV_0485 UPF0301 protein BOV_0485 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q2GAJ3 5.46e-39 134 33 2 183 3 Saro_0683 UPF0301 protein Saro_0683 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q6NBB5 1.22e-38 134 37 4 193 3 RPA0913 UPF0301 protein RPA0913 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q3SNY6 3.39e-38 133 37 4 193 3 Nwi_2752 UPF0301 protein Nwi_2752 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A9IQR9 5.42e-38 132 34 2 188 3 BT_0659 UPF0301 protein BT_0659 Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q2IRH5 6.6e-38 132 36 4 193 3 RPB_4502 UPF0301 protein RPB_4502 Rhodopseudomonas palustris (strain HaA2)
B7I3Q5 1.07e-37 131 37 3 185 3 AB57_0401 UPF0301 protein AB57_0401 Acinetobacter baumannii (strain AB0057)
B0VE54 1.07e-37 131 37 3 185 3 ABAYE3454 UPF0301 protein ABAYE3454 Acinetobacter baumannii (strain AYE)
B2I2L3 1.07e-37 131 37 3 185 3 ACICU_00336 UPF0301 protein ACICU_00336 Acinetobacter baumannii (strain ACICU)
B7H1G7 1.07e-37 131 37 3 185 3 ABBFA_003217 UPF0301 protein ABBFA_003217 Acinetobacter baumannii (strain AB307-0294)
B0VLV9 1.07e-37 131 37 3 185 3 ABSDF3201 UPF0301 protein ABSDF3201 Acinetobacter baumannii (strain SDF)
A8IM50 1.5e-37 131 35 4 195 3 AZC_0488 UPF0301 protein AZC_0488 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q6AL28 1.76e-37 130 39 4 189 3 DP2218 UPF0301 protein DP2218 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A7IIJ3 3.65e-37 130 36 5 192 3 Xaut_2594 UPF0301 protein Xaut_2594 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q21B77 9.87e-37 129 37 4 193 3 RPC_0788 UPF0301 protein RPC_0788 Rhodopseudomonas palustris (strain BisB18)
Q6FF54 1.19e-36 128 37 3 186 1 ACIAD0353 UPF0301 protein ACIAD0353 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q6G4C1 2.87e-34 122 31 3 188 3 BH04450 UPF0301 protein BH04450 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q5FQY8 8.22e-34 121 33 3 189 3 GOX1459 UPF0301 protein GOX1459 Gluconobacter oxydans (strain 621H)
Q6G0C7 9.48e-33 119 32 2 188 3 BQ03640 UPF0301 protein BQ03640 Bartonella quintana (strain Toulouse)
C0QFZ0 7.41e-32 116 32 1 185 3 HRM2_24640 UPF0301 protein HRM2_24640 Desulforapulum autotrophicum (strain ATCC 43914 / DSM 3382 / VKM B-1955 / HRM2)
Q5NQN1 2.19e-31 115 30 1 176 3 ZMO0349 UPF0301 protein ZMO0349 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q2IGM2 2.12e-29 110 33 3 178 3 Adeh_3962 UPF0301 protein Adeh_3962 Anaeromyxobacter dehalogenans (strain 2CP-C)
B8J9N6 3.4e-29 109 34 3 178 3 A2cp1_4106 UPF0301 protein A2cp1_4106 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
B0U0F0 3.73e-29 109 36 5 176 3 Fphi_1754 UPF0301 protein Fphi_1754 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
B2SGN2 2.35e-28 107 35 5 180 3 FTM_0963 UPF0301 protein FTM_0963 Francisella tularensis subsp. mediasiatica (strain FSC147)
A7NCQ8 4.93e-28 106 35 5 176 3 FTA_1286 UPF0301 protein FTA_1286 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q5NG69 9.18e-28 106 35 5 176 3 FTT_0985 UPF0301 protein FTT_0985 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14HM1 9.18e-28 106 35 5 176 3 FTF0985 UPF0301 protein FTF0985 Francisella tularensis subsp. tularensis (strain FSC 198)
A4IXT7 9.18e-28 106 35 5 176 3 FTW_0891 UPF0301 protein FTW_0891 Francisella tularensis subsp. tularensis (strain WY96-3418)
A0Q689 9.18e-28 106 35 5 176 3 FTN_0866 UPF0301 protein FTN_0866 Francisella tularensis subsp. novicida (strain U112)
Q2A303 9.18e-28 106 35 5 176 3 FTL_1216 UPF0301 protein FTL_1216 Francisella tularensis subsp. holarctica (strain LVS)
Q0BLI0 9.18e-28 106 35 5 176 3 FTH_1193 UPF0301 protein FTH_1193 Francisella tularensis subsp. holarctica (strain OSU18)
B4UGJ6 2.01e-27 105 33 3 178 3 AnaeK_4073 UPF0301 protein AnaeK_4073 Anaeromyxobacter sp. (strain K)
A8GUE4 1.17e-26 103 28 3 188 3 A1I_00140 UPF0301 protein A1I_00140 Rickettsia bellii (strain OSU 85-389)
Q1RKK6 1.17e-26 103 28 3 188 3 RBE_0027 UPF0301 protein RBE_0027 Rickettsia bellii (strain RML369-C)
A8GLU3 1.4e-26 102 27 2 187 3 A1C_00165 UPF0301 protein A1C_00165 Rickettsia akari (strain Hartford)
Q4UNH2 4.52e-26 101 28 3 188 3 RF_0044 UPF0301 protein RF_0044 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q9ZEB3 5.72e-26 101 27 3 188 3 RP032 UPF0301 protein RP032 Rickettsia prowazekii (strain Madrid E)
A8EX98 8.97e-26 100 28 3 188 3 A1E_00140 UPF0301 protein A1E_00140 Rickettsia canadensis (strain McKiel)
Q60BQ2 1.26e-25 100 31 2 174 3 MCA0413 UPF0301 protein MCA0413 1 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q68XQ8 1.44e-25 100 27 3 189 3 RT0098 UPF0301 protein RT0098 Rickettsia typhi (strain ATCC VR-144 / Wilmington)
A8F0D7 1.94e-25 100 27 3 188 3 RMA_0049 UPF0301 protein RMA_0049 Rickettsia massiliae (strain Mtu5)
C4K0Q1 2.48e-25 99 28 3 188 3 RPR_01165 UPF0301 protein RPR_01165 Rickettsia peacockii (strain Rustic)
Q92JM4 3.04e-25 99 28 3 188 3 RC0043 UPF0301 protein RC0043 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
A8GQH5 3.28e-25 99 28 3 188 3 A1G_00270 UPF0301 protein A1G_00270 Rickettsia rickettsii (strain Sheila Smith)
B0BVW3 3.28e-25 99 28 3 188 3 RrIowa_0061 UPF0301 protein RrIowa_0061 Rickettsia rickettsii (strain Iowa)
A7H7H6 3.44e-25 99 30 5 181 3 Anae109_0457 UPF0301 protein Anae109_0457 Anaeromyxobacter sp. (strain Fw109-5)
C3PM61 1.17e-24 97 27 3 188 3 RAF_ORF0041 UPF0301 protein RAF_ORF0041 Rickettsia africae (strain ESF-5)
B3EHS7 1.44e-22 92 30 3 176 3 Clim_0777 UPF0301 protein Clim_0777 Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
O84213 5.58e-22 90 33 4 175 3 CT_211 UPF0301 protein CT_211 Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
B0B9W1 1.62e-21 89 33 4 175 3 CTL0463 UPF0301 protein CTL0463 Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
B0BBJ1 1.62e-21 89 33 4 175 3 CTLon_0458 UPF0301 protein CTLon_0458 Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
Q1DAS2 2.86e-21 89 34 4 176 3 MXAN_2022 UPF0301 protein MXAN_2022 Myxococcus xanthus (strain DK1622)
Q3KMF1 7.87e-21 88 33 5 175 3 CTA_0231 UPF0301 protein CTA_0231 Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
A6LBX4 1.89e-20 87 33 4 175 3 BDI_1431 UPF0301 protein BDI_1431 Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q2S591 1.8e-19 84 29 5 171 3 SRU_0495 UPF0301 protein SRU_0495 Salinibacter ruber (strain DSM 13855 / M31)
Q8KEM4 2.24e-19 84 30 4 170 3 CT0663 UPF0301 protein CT0663 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q9PKI2 2.44e-19 84 31 3 175 3 TC_0483 UPF0301 protein TC_0483 Chlamydia muridarum (strain MoPn / Nigg)
Q11U74 7.08e-19 82 30 5 178 3 CHU_1773 UPF0301 protein CHU_1773 Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
Q6MAC0 2.61e-18 81 28 1 175 3 pc1755 UPF0301 protein pc1755 Protochlamydia amoebophila (strain UWE25)
A1BEV6 7.03e-18 80 28 2 176 3 Cpha266_0885 UPF0301 protein Cpha266_0885 Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q8A8T9 8.03e-18 80 32 4 178 3 BT_1078 UPF0301 protein BT_1078 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q3B561 1.72e-17 79 28 2 176 3 Plut_0637 UPF0301 protein Plut_0637 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
Q822P9 2.34e-17 79 26 3 175 3 CCA_00630 UPF0301 protein CCA_00630 Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q3AQ69 4e-17 78 29 4 169 3 Cag_1601 UPF0301 protein Cag_1601 Chlorobium chlorochromatii (strain CaD3)
B3QMC9 5.43e-17 77 28 4 177 3 Cpar_0662 UPF0301 protein Cpar_0662 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
B4SD86 7.92e-17 77 27 2 176 3 Ppha_2142 UPF0301 protein Ppha_2142 Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q5L5N9 8.79e-17 77 28 4 156 3 CAB604 UPF0301 protein CAB604 Chlamydia abortus (strain DSM 27085 / S26/3)
A0Q8W4 1.14e-16 77 29 4 166 3 MAV_0052 UPF0301 protein MAV_0052 Mycobacterium avium (strain 104)
Q744T3 1.14e-16 77 29 4 166 3 MAP_0045 UPF0301 protein MAP_0045 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
B2HI98 1.43e-16 77 30 4 166 3 MMAR_0053 UPF0301 protein MMAR_0053 Mycobacterium marinum (strain ATCC BAA-535 / M)
A0PKF8 1.43e-16 77 30 4 166 3 MUL_0052 UPF0301 protein MUL_0052 Mycobacterium ulcerans (strain Agy99)
Q254Z3 1.85e-16 76 27 3 175 3 CF0373 UPF0301 protein CF0373 Chlamydia felis (strain Fe/C-56)
Q9Z944 3.67e-16 75 25 3 174 3 CPn_0139 UPF0301 protein CPn_0139/CP_0633/CPj0139/CpB0140 Chlamydia pneumoniae
Q5LDK5 5.93e-16 75 28 4 176 3 BF2109 UPF0301 protein BF2109 Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q64UM6 5.93e-16 75 28 4 176 3 BF2056 UPF0301 protein BF2056 Bacteroides fragilis (strain YCH46)
A1KEK6 2.68e-15 73 29 5 167 3 BCG_0069 UPF0301 protein BCG_0069 Mycobacterium bovis (strain BCG / Pasteur 1173P2)
A5TYA9 2.68e-15 73 29 5 167 3 MRA_0041 UPF0301 protein MRA_0041 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AJ35 2.68e-15 73 29 5 167 3 JTY_0039 UPF0301 protein JTY_0039 Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
P67758 2.68e-15 73 29 5 167 3 BQ2027_MB0039 UPF0301 protein Mb0039 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WFK5 2.68e-15 73 29 5 167 1 Rv0038 UPF0301 protein Rv0038 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WFK4 2.68e-15 73 29 5 167 3 MT0043 UPF0301 protein MT0043 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
B1MML1 4.97e-15 73 30 4 166 3 MAB_4928c UPF0301 protein MAB_4928c Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
A1TI09 5.03e-15 73 28 4 166 3 Mvan_6057 UPF0301 protein Mvan_6057 Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q5YN78 1.21e-14 72 30 5 159 3 NFA_55110 UPF0301 protein NFA_55110 Nocardia farcinica (strain IFM 10152)
C0ZVL8 7.03e-14 70 25 5 166 3 RER_60040 UPF0301 protein RER_60040 Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q50191 1.1e-13 69 28 4 166 3 ML0028 UPF0301 protein ML0028 Mycobacterium leprae (strain TN)
Q82D55 1.24e-13 69 27 5 172 3 SAV_5129 UPF0301 protein SAV_5129 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q9L1U6 1.84e-13 68 27 6 174 3 SCO2948 UPF0301 protein SCO2948 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
C1B7P4 1.94e-13 68 30 5 150 3 ROP_34500 UPF0301 protein ROP_34500 Rhodococcus opacus (strain B4)
A0R7H8 2.51e-13 68 27 4 166 3 MSMEG_6921 UPF0301 protein MSMEG_6921/MSMEI_6732 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q0SAK3 4.9e-13 67 29 5 151 3 RHA1_ro03630 UPF0301 protein RHA1_ro03630 Rhodococcus jostii (strain RHA1)
Q47MA0 5.98e-13 67 29 5 167 3 Tfu_2389 UPF0301 protein Tfu_2389 Thermobifida fusca (strain YX)
A4T4R8 1.3e-12 66 29 4 168 3 Mflv_0850 UPF0301 protein Mflv_0850 Mycolicibacterium gilvum (strain PYR-GCK)
Q8FSW7 4.7e-06 48 25 5 163 3 CE2927 UPF0301 protein CE2927 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q8NL65 5.85e-05 45 24 4 158 3 Cgl3084 UPF0301 protein Cgl3084/cg3414 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS01620
Feature type CDS
Gene -
Product YqgE/AlgH family protein
Location 388298 - 388861 (strand: -1)
Length 564 (nucleotides) / 187 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2040
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02622 Uncharacterized ACR, COG1678

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1678 Transcription (K) K Putative transcriptional regulator, AlgH/UPF0301 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K07735 putative transcriptional regulator - -

Protein Sequence

MNLLNHFLIAMPSLSDPLFQRSVVYVCEHNENGAMGLVINKPIEDISIESVLEQLEIFSADRDSAISLQKPVMSGGPVAEEHGFILHTPVSGFSSSIKISDSTMITTSKDVLETLGTARQPEKTLVSLGYSSWEKGQLEREILENSWLTVEATPQIIFDTPIAERWHKAAELIGIDIHTISPTAGHA

Flanking regions ( +/- flanking 50bp)

AATAGGGCTAGGTTTTTTAATAAAAACAATCAGAGAACAGTATTACTATTATGAATTTACTCAACCATTTTCTTATTGCTATGCCATCATTAAGCGATCCGCTCTTTCAACGCTCGGTCGTCTATGTTTGCGAACATAATGAAAACGGTGCAATGGGTTTAGTTATTAATAAGCCGATTGAAGATATCTCTATTGAAAGTGTCTTAGAGCAGTTGGAGATATTCTCAGCAGATAGAGATAGTGCGATTAGCTTACAAAAACCGGTTATGTCTGGTGGCCCTGTAGCGGAAGAGCATGGTTTTATCTTACACACCCCTGTTTCTGGTTTTAGCTCAAGTATTAAAATCAGCGATAGCACCATGATCACCACGTCAAAAGATGTGTTAGAAACATTAGGTACAGCAAGACAGCCTGAAAAAACCTTAGTCTCATTAGGATATTCCAGTTGGGAAAAAGGCCAGCTCGAGAGAGAAATTTTAGAAAATAGTTGGCTTACCGTTGAAGCAACCCCACAAATCATTTTTGATACCCCAATTGCAGAGCGTTGGCATAAAGCCGCCGAACTAATTGGTATCGATATCCACACAATTTCACCAACGGCTGGTCATGCATAATGTCAAATAGAACGGTAATGGGGTTTGATTTTGGCACCAAAAGTATTGGA