Homologs in group_82

Help

11 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04895 FBDBKF_04895 57.7 Morganella morganii S1 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
FBDBKF_10875 FBDBKF_10875 62.9 Morganella morganii S1 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
EHELCC_05350 EHELCC_05350 62.9 Morganella morganii S2 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
EHELCC_06185 EHELCC_06185 57.7 Morganella morganii S2 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
NLDBIP_05670 NLDBIP_05670 62.9 Morganella morganii S4 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
NLDBIP_06505 NLDBIP_06505 57.7 Morganella morganii S4 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
LHKJJB_02550 LHKJJB_02550 62.9 Morganella morganii S3 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
LHKJJB_03385 LHKJJB_03385 57.7 Morganella morganii S3 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
HKOGLL_06860 HKOGLL_06860 57.7 Morganella morganii S5 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
HKOGLL_15930 HKOGLL_15930 62.9 Morganella morganii S5 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
F4V73_RS11535 F4V73_RS11535 58.3 Morganella psychrotolerans - TetR/AcrR family transcriptional regulator

Distribution of the homologs in the orthogroup group_82

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_82

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q3J6K8 5.48e-43 147 36 3 208 1 acuR Transcriptional regulator AcuR Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q9RAJ1 1.32e-22 94 27 1 184 4 dhaR HTH-type transcriptional repressor DhaR Mycobacterium sp. (strain GP1)
P67430 1.25e-13 70 22 0 183 1 nemR HTH-type transcriptional repressor NemR Escherichia coli (strain K12)
P67431 1.25e-13 70 22 0 183 3 nemR HTH-type transcriptional repressor NemR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P42097 6.33e-09 57 28 7 187 4 None Uncharacterized HTH-type transcriptional regulator in lacX 3'region Lactococcus lactis subsp. lactis
O31500 5.09e-06 49 28 1 107 4 yerO Uncharacterized HTH-type transcriptional regulator YerO Bacillus subtilis (strain 168)
P40950 3.09e-05 47 37 0 54 4 yuxN Uncharacterized HTH-type transcriptional regulator YuxN Bacillus subtilis (strain 168)
O34619 0.000253 43 21 3 115 4 lmrA HTH-type transcriptional regulator LmrA Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS01470
Feature type CDS
Gene -
Product TetR/AcrR family transcriptional regulator
Location 360449 - 361141 (strand: -1)
Length 693 (nucleotides) / 230 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_82
Orthogroup size 12
N. genomes 7

Actions

Genomic region

Domains

PF00440 Bacterial regulatory proteins, tetR family
PF16925 Tetracyclin repressor-like, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1309 Transcription (K) K DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K16137 TetR/AcrR family transcriptional regulator, transcriptional repressor for nem operon - -

Protein Sequence

MMISEITKLKRGRPPKNHSPNTDVKNIVIQSGIEMFAEKGYISSDICKILEKVGIPKGSFYYYFGSKEKFGLVVIQHYDNFISKQLDNYLSYTALPFPKRLLAFCHMIKSEMEKYHWQRGCLVSNLIQDIVNLPINYYKILNNVISGWQKKVENYLLEAQKYKFISKNIDCRQMAIFFWMGWQGAIMQAKLTCSNQPLDIFISIFMAQVFGIHYQASEYPILFNKNTFTN

Flanking regions ( +/- flanking 50bp)

CAGGTACTCAATAAGCTACCTGTATGCTCCCCTGTCGTGGAGATAGCAAAATGATGATATCAGAAATCACCAAACTGAAACGAGGACGTCCCCCCAAAAATCATAGTCCTAATACAGATGTAAAAAATATAGTTATTCAAAGTGGTATAGAAATGTTTGCTGAAAAAGGCTATATCAGTTCAGACATTTGTAAGATATTAGAAAAAGTTGGTATCCCGAAAGGATCATTTTATTATTACTTTGGTAGTAAAGAAAAATTTGGTTTAGTCGTCATCCAACATTATGACAACTTTATTTCTAAGCAACTAGATAACTATTTGTCTTATACTGCATTACCTTTCCCCAAAAGACTATTAGCATTTTGTCACATGATAAAATCAGAAATGGAAAAGTATCATTGGCAACGAGGATGCTTAGTAAGTAATCTCATACAAGATATTGTTAATTTACCCATTAACTATTATAAAATACTGAATAATGTGATTTCTGGATGGCAGAAAAAGGTAGAAAATTATCTTCTAGAAGCACAAAAATATAAGTTTATATCTAAAAACATTGATTGTAGACAAATGGCTATTTTTTTCTGGATGGGTTGGCAAGGAGCAATAATGCAAGCAAAACTAACCTGCTCTAATCAGCCACTAGATATATTTATCTCTATTTTTATGGCGCAGGTGTTTGGTATTCATTATCAAGCGTCAGAATATCCCATTCTATTTAATAAAAATACTTTTACTAACTAATTTTTTTAAAAAAAAGAAACAACTTATCAATAAAGATTTATTATTAAGTT