Homologs in group_82

Help

11 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_04895 FBDBKF_04895 77.6 Morganella morganii S1 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
FBDBKF_10875 FBDBKF_10875 100.0 Morganella morganii S1 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
EHELCC_05350 EHELCC_05350 100.0 Morganella morganii S2 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
EHELCC_06185 EHELCC_06185 77.6 Morganella morganii S2 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
NLDBIP_06505 NLDBIP_06505 77.6 Morganella morganii S4 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
LHKJJB_02550 LHKJJB_02550 100.0 Morganella morganii S3 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
LHKJJB_03385 LHKJJB_03385 77.6 Morganella morganii S3 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
HKOGLL_06860 HKOGLL_06860 77.6 Morganella morganii S5 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
HKOGLL_15930 HKOGLL_15930 100.0 Morganella morganii S5 acrR DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
F4V73_RS11535 F4V73_RS11535 69.0 Morganella psychrotolerans - TetR/AcrR family transcriptional regulator
PMI_RS01470 PMI_RS01470 62.9 Proteus mirabilis HI4320 - TetR/AcrR family transcriptional regulator

Distribution of the homologs in the orthogroup group_82

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_82

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q3J6K8 4.66e-52 170 39 1 208 1 acuR Transcriptional regulator AcuR Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q9RAJ1 1.98e-33 121 34 1 191 4 dhaR HTH-type transcriptional repressor DhaR Mycobacterium sp. (strain GP1)
P67430 7.48e-16 75 26 0 183 1 nemR HTH-type transcriptional repressor NemR Escherichia coli (strain K12)
P67431 7.48e-16 75 26 0 183 3 nemR HTH-type transcriptional repressor NemR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P42105 1.03e-09 58 21 4 185 1 yxaF Uncharacterized HTH-type transcriptional regulator YxaF Bacillus subtilis (strain 168)
P42097 3.33e-08 55 27 7 193 4 None Uncharacterized HTH-type transcriptional regulator in lacX 3'region Lactococcus lactis subsp. lactis
O34619 8.17e-06 48 28 1 75 4 lmrA HTH-type transcriptional regulator LmrA Bacillus subtilis (strain 168)
P9WMB9 0.00011 45 30 2 92 1 kstR2 HTH-type transcriptional repressor KstR2 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WMB8 0.00011 45 30 2 92 3 kstR2 HTH-type transcriptional repressor KstR2 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P40950 0.000116 45 29 1 64 4 yuxN Uncharacterized HTH-type transcriptional regulator YuxN Bacillus subtilis (strain 168)
P94548 0.000228 43 34 0 50 1 fadR Fatty acid metabolism regulator protein Bacillus subtilis (strain 168)
O31500 0.000777 43 28 0 78 4 yerO Uncharacterized HTH-type transcriptional regulator YerO Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_05670
Feature type CDS
Gene acrR
Product DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA
Location 95516 - 96148 (strand: -1)
Length 633 (nucleotides) / 210 (amino acids)
In genomic island -

Contig

Accession ZDB_521
Length 325332 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_82
Orthogroup size 12
N. genomes 7

Actions

Genomic region

Domains

PF00440 Bacterial regulatory proteins, tetR family
PF16925 Tetracyclin repressor-like, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1309 Transcription (K) K DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K16137 TetR/AcrR family transcriptional regulator, transcriptional repressor for nem operon - -

Protein Sequence

MTAIMTKPKRGRPPKNHDAGTDVKEILIRSGTEVFTETGYMTSDISRILTKAGIPKGSFYYYFGSKENFGVKVIRHYDRCFSHLLDKCLSDTTLPPPERLLTFCSITKSGMEKYHWQRGCLIGNLGQEVISLPAGYCELLNDIITGWQKKVENCLLEAQAQNLISGNTDCRQMAAFFWAGWEGAVMRAKLTRNGEPLDLFITIFMKQILV

Flanking regions ( +/- flanking 50bp)

ATGTATACGAACAGCAATCTGTATATTCCGCATAACAGAGATAAAACGTAATGACAGCAATAATGACAAAGCCGAAACGGGGACGACCGCCGAAAAACCATGATGCAGGTACCGATGTAAAAGAAATATTGATCCGCAGCGGTACGGAGGTGTTTACCGAAACAGGATATATGACGTCAGATATCAGCAGAATATTAACAAAAGCAGGTATTCCGAAGGGATCTTTTTATTATTACTTTGGCAGTAAAGAAAATTTCGGTGTGAAAGTGATACGTCATTATGACCGCTGTTTTTCTCATCTGCTGGATAAATGTCTGTCTGATACCACATTGCCGCCACCGGAAAGATTACTGACATTTTGCAGTATCACTAAGTCCGGAATGGAAAAATATCACTGGCAGCGCGGGTGTCTGATCGGCAATCTCGGGCAGGAAGTTATCAGTCTGCCGGCCGGGTATTGTGAATTACTCAATGACATTATTACCGGCTGGCAAAAGAAAGTGGAGAATTGTCTTCTGGAAGCACAGGCGCAAAATCTTATTTCCGGAAATACTGACTGCAGGCAGATGGCGGCTTTTTTCTGGGCGGGCTGGGAAGGGGCGGTCATGCGTGCCAAACTGACCCGTAACGGTGAACCGCTGGATCTGTTTATTACAATTTTTATGAAGCAGATACTGGTATAACAGCCGGAAAGATGATGATTCCGGGCTGAAAAATGGTTTTCTCTGATAGC