Homologs in group_2425

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19570 FBDBKF_19570 40.0 Morganella morganii S1 hipB Transcriptional regulator, contains XRE-family HTH domain
EHELCC_16515 EHELCC_16515 40.0 Morganella morganii S2 hipB Transcriptional regulator, contains XRE-family HTH domain
NLDBIP_16725 NLDBIP_16725 40.0 Morganella morganii S4 hipB Transcriptional regulator, contains XRE-family HTH domain
LHKJJB_16745 LHKJJB_16745 40.0 Morganella morganii S3 hipB Transcriptional regulator, contains XRE-family HTH domain
HKOGLL_18870 HKOGLL_18870 40.0 Morganella morganii S5 hipB Transcriptional regulator, contains XRE-family HTH domain
F4V73_RS18560 F4V73_RS18560 42.9 Morganella psychrotolerans - helix-turn-helix transcriptional regulator

Distribution of the homologs in the orthogroup group_2425

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2425

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q92HV3 4.72e-09 52 42 0 64 4 RC0668 Uncharacterized HTH-type transcriptional regulator RC0668 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q9ZD50 1.81e-08 51 40 0 64 4 RP497 Uncharacterized HTH-type transcriptional regulator RP497 Rickettsia prowazekii (strain Madrid E)
P15017 2.58e-08 50 35 1 71 4 None Uncharacterized transcriptional regulator in ATPase CF(0) region Rhodospirillum rubrum
P0C5S2 7.13e-05 42 24 0 74 4 R00410 Uncharacterized HTH-type transcriptional regulator R00410 Rhizobium meliloti (strain 1021)
A6U5H5 7.13e-05 42 24 0 74 4 Smed_0045 Uncharacterized HTH-type transcriptional regulator Smed_0045 Sinorhizobium medicae (strain WSM419)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS01425
Feature type CDS
Gene -
Product helix-turn-helix transcriptional regulator
Location 352544 - 352828 (strand: 1)
Length 285 (nucleotides) / 94 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2425
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Protein Sequence

MEREKYEIDKTYDTKAIHQYLGKEIRSKRKAIGLTGEDLAKKLNVSQQQVSRYETAESKISFEKLLLISDVLDLNIQYLLKVIISDKFKIISDD

Flanking regions ( +/- flanking 50bp)

TATTTTAGCATGATATATCCCATTTTTATAAAGCTAATAGAAAATAGATTATGGAAAGAGAAAAATACGAAATTGATAAAACTTACGATACTAAAGCTATTCATCAATACTTAGGGAAAGAGATCCGTTCAAAAAGAAAAGCGATAGGACTAACAGGTGAAGATTTAGCTAAAAAGTTAAATGTCAGTCAACAGCAGGTATCTAGATATGAAACAGCAGAGTCAAAAATAAGCTTTGAAAAGCTATTGTTAATATCTGATGTTCTAGATCTTAATATTCAATATCTATTAAAAGTTATCATTAGTGATAAATTTAAAATTATTTCTGATGATTAGCTTTTAATTAAATTCTATGGACAAGATTCCAATATGGATATTTATATTTT