Homologs in group_393

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19570 FBDBKF_19570 84.3 Morganella morganii S1 hipB Transcriptional regulator, contains XRE-family HTH domain
EHELCC_16515 EHELCC_16515 84.3 Morganella morganii S2 hipB Transcriptional regulator, contains XRE-family HTH domain
NLDBIP_16725 NLDBIP_16725 84.3 Morganella morganii S4 hipB Transcriptional regulator, contains XRE-family HTH domain
LHKJJB_16745 LHKJJB_16745 84.3 Morganella morganii S3 hipB Transcriptional regulator, contains XRE-family HTH domain
HKOGLL_18870 HKOGLL_18870 84.3 Morganella morganii S5 hipB Transcriptional regulator, contains XRE-family HTH domain
PMI_RS01425 PMI_RS01425 42.9 Proteus mirabilis HI4320 - helix-turn-helix transcriptional regulator

Distribution of the homologs in the orthogroup group_393

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_393

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q92HV3 3.59e-10 54 37 0 62 4 RC0668 Uncharacterized HTH-type transcriptional regulator RC0668 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q9ZD50 1.3e-09 53 35 0 62 4 RP497 Uncharacterized HTH-type transcriptional regulator RP497 Rickettsia prowazekii (strain Madrid E)
P15017 1.8e-06 44 30 0 63 4 None Uncharacterized transcriptional regulator in ATPase CF(0) region Rhodospirillum rubrum
P0C5S2 1.56e-05 42 26 0 65 4 R00410 Uncharacterized HTH-type transcriptional regulator R00410 Rhizobium meliloti (strain 1021)
A6U5H5 1.56e-05 42 26 0 65 4 Smed_0045 Uncharacterized HTH-type transcriptional regulator Smed_0045 Sinorhizobium medicae (strain WSM419)
P55681 4.98e-05 41 26 0 64 4 NGR_a01020 Uncharacterized HTH-type transcriptional regulator y4wC Sinorhizobium fredii (strain NBRC 101917 / NGR234)
O34647 0.000425 38 33 1 59 4 yobD Uncharacterized HTH-type transcriptional regulator YobD Bacillus subtilis (strain 168)
P55360 0.000433 39 26 0 68 4 NGR_a00350 Uncharacterized HTH-type transcriptional regulator y4aM Sinorhizobium fredii (strain NBRC 101917 / NGR234)
P96631 0.000527 38 32 0 62 1 immR HTH-type transcriptional regulator ImmR Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS18560
Feature type CDS
Gene -
Product helix-turn-helix transcriptional regulator
Location 52698 - 52910 (strand: 1)
Length 213 (nucleotides) / 70 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000009
Length 74461 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_393
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Protein Sequence

MFIGKKIKCQRISRCLTGRELSMKINISQQQLSRYETGASLIPLDKLLMLADVLNINVNYFFDDTRCDEE

Flanking regions ( +/- flanking 50bp)

CCGTTTATCTAAAATAATTTATGACAACATATGATAAATATGAGTTGGCGATGTTTATTGGCAAAAAAATAAAGTGTCAGCGTATTTCCCGATGCCTGACAGGAAGAGAACTGTCAATGAAAATTAATATCTCACAGCAACAGCTATCCCGATATGAAACGGGGGCGAGTTTAATTCCGCTTGATAAGCTATTAATGCTCGCTGACGTCCTGAATATTAATGTTAATTATTTTTTTGATGATACCCGTTGTGATGAAGAATAGCCTTTAATTTGACAAACATTAATATGTAATTAACCAGACTGACAGATGAT