Homologs in group_26

Help

13 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08950 FBDBKF_08950 42.2 Morganella morganii S1 hipB Transcriptional regulator, contains XRE-family HTH domain
FBDBKF_09005 FBDBKF_09005 40.2 Morganella morganii S1 hipB Transcriptional regulator, contains XRE-family HTH domain
EHELCC_10405 EHELCC_10405 40.2 Morganella morganii S2 hipB Transcriptional regulator, contains XRE-family HTH domain
EHELCC_10460 EHELCC_10460 42.2 Morganella morganii S2 hipB Transcriptional regulator, contains XRE-family HTH domain
NLDBIP_10750 NLDBIP_10750 40.2 Morganella morganii S4 hipB Transcriptional regulator, contains XRE-family HTH domain
NLDBIP_10805 NLDBIP_10805 42.2 Morganella morganii S4 hipB Transcriptional regulator, contains XRE-family HTH domain
LHKJJB_10550 LHKJJB_10550 42.2 Morganella morganii S3 hipB Transcriptional regulator, contains XRE-family HTH domain
LHKJJB_10605 LHKJJB_10605 40.2 Morganella morganii S3 hipB Transcriptional regulator, contains XRE-family HTH domain
HKOGLL_13610 HKOGLL_13610 42.2 Morganella morganii S5 hipB Transcriptional regulator, contains XRE-family HTH domain
HKOGLL_13665 HKOGLL_13665 40.2 Morganella morganii S5 hipB Transcriptional regulator, contains XRE-family HTH domain
F4V73_RS10965 F4V73_RS10965 40.2 Morganella psychrotolerans - helix-turn-helix transcriptional regulator
F4V73_RS11020 F4V73_RS11020 41.0 Morganella psychrotolerans - helix-turn-helix transcriptional regulator
PMI_RS01315 PMI_RS01315 64.2 Proteus mirabilis HI4320 mrpJ transcriptional regulator MrpJ

Distribution of the homologs in the orthogroup group_26

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_26

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0C5S2 1.05e-11 60 33 0 77 4 R00410 Uncharacterized HTH-type transcriptional regulator R00410 Rhizobium meliloti (strain 1021)
A6U5H5 1.05e-11 60 33 0 77 4 Smed_0045 Uncharacterized HTH-type transcriptional regulator Smed_0045 Sinorhizobium medicae (strain WSM419)
P15017 4e-11 58 45 0 66 4 None Uncharacterized transcriptional regulator in ATPase CF(0) region Rhodospirillum rubrum
Q92HV3 3.32e-08 50 36 0 65 4 RC0668 Uncharacterized HTH-type transcriptional regulator RC0668 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
P55681 3.73e-08 51 34 0 75 4 NGR_a01020 Uncharacterized HTH-type transcriptional regulator y4wC Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9ZD50 1.16e-07 49 35 0 65 4 RP497 Uncharacterized HTH-type transcriptional regulator RP497 Rickettsia prowazekii (strain Madrid E)
Q8TZX4 0.000239 42 30 0 55 3 PF1851 Putative HTH-type transcriptional regulatory protein PF1851 Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
O59472 0.000353 41 32 0 55 3 PH1808 Putative HTH-type transcriptional regulatory protein PH1808 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS01265
Feature type CDS
Gene -
Product helix-turn-helix transcriptional regulator
Location 309216 - 309536 (strand: 1)
Length 321 (nucleotides) / 106 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_26
Orthogroup size 14
N. genomes 7

Actions

Genomic region

Domains

PF01381 Helix-turn-helix

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1396 Transcription (K) K Transcriptional regulator, contains XRE-family HTH domain

Virulence factor Annotation(s)

VF gene ID Protein VF ID Category
VFG042629 transcriptional regulator MrpJ VF1233 Adherence

Protein Sequence

MVKYRRANIDVNALVGKRIQKRRKELGYTGSQLAAKLGVSQQQFSRYERGLNKIDLTYLVLLAKFLNTPIYWFFEDCITSTSVKSGKPLSRRSNLLAKKALDAFLY

Flanking regions ( +/- flanking 50bp)

TCTGGCGCGTTGATTCTAACGTTACCATAATAATAAAAGGTTGAAATATCATGGTGAAATATCGTCGTGCAAATATTGATGTCAATGCACTGGTAGGTAAGCGCATACAAAAAAGGCGTAAAGAGTTAGGTTACACAGGTAGCCAATTGGCGGCAAAACTAGGGGTTAGCCAACAACAATTCTCACGCTATGAGCGAGGGTTAAACAAAATAGATCTTACTTATCTAGTGCTATTAGCTAAATTCTTAAACACACCTATTTACTGGTTTTTTGAGGACTGTATTACTTCAACGTCGGTCAAAAGTGGCAAACCGCTAAGTCGACGAAGCAATCTTTTAGCCAAAAAAGCACTAGACGCATTTCTGTATTAACCTTTACCTCTTACAAGAAAAAGTCCTTAAATAAGCAACCTATTTAGGTC