Homologs in group_1865

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13945 FBDBKF_13945 78.2 Morganella morganii S1 rnhA ribonuclease HI
EHELCC_11615 EHELCC_11615 78.2 Morganella morganii S2 rnhA ribonuclease HI
NLDBIP_11960 NLDBIP_11960 78.2 Morganella morganii S4 rnhA ribonuclease HI
LHKJJB_11820 LHKJJB_11820 78.2 Morganella morganii S3 rnhA ribonuclease HI
HKOGLL_10430 HKOGLL_10430 78.2 Morganella morganii S5 rnhA ribonuclease HI
F4V73_RS12800 F4V73_RS12800 76.1 Morganella psychrotolerans rnhA ribonuclease HI

Distribution of the homologs in the orthogroup group_1865

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1865

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EUG3 5.46e-119 335 100 0 159 3 rnhA Ribonuclease H Proteus mirabilis (strain HI4320)
Q7N807 1.64e-96 278 81 0 155 3 rnhA Ribonuclease H Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8GF77 8.32e-95 274 80 0 155 3 rnhA Ribonuclease H Photorhabdus luminescens
A1JKB1 7.98e-89 258 77 0 151 3 rnhA Ribonuclease H Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JR46 8.9e-89 258 76 0 151 3 rnhA Ribonuclease H Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q667M7 8.9e-89 258 76 0 151 3 rnhA Ribonuclease H Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TL54 8.9e-89 258 76 0 151 3 rnhA Ribonuclease H Yersinia pestis (strain Pestoides F)
Q1CFI6 8.9e-89 258 76 0 151 3 rnhA Ribonuclease H Yersinia pestis bv. Antiqua (strain Nepal516)
A9R0G0 8.9e-89 258 76 0 151 3 rnhA Ribonuclease H Yersinia pestis bv. Antiqua (strain Angola)
Q8ZH30 8.9e-89 258 76 0 151 3 rnhA Ribonuclease HI Yersinia pestis
B2KAC9 8.9e-89 258 76 0 151 3 rnhA Ribonuclease H Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CAJ5 8.9e-89 258 76 0 151 3 rnhA Ribonuclease H Yersinia pestis bv. Antiqua (strain Antiqua)
A7FFK7 8.9e-89 258 76 0 151 3 rnhA Ribonuclease H Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8AKR0 1.15e-87 256 77 0 151 3 rnhA Ribonuclease H Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q6D1V7 1.96e-87 255 76 0 151 3 rnhA Ribonuclease H Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P0A2B9 1.98e-87 255 77 0 151 3 rnhA Ribonuclease HI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2C0 1.98e-87 255 77 0 151 3 rnhA Ribonuclease HI Salmonella typhi
B4TYH0 1.98e-87 255 77 0 151 3 rnhA Ribonuclease H Salmonella schwarzengrund (strain CVM19633)
B5BDW5 1.98e-87 255 77 0 151 3 rnhA Ribonuclease H Salmonella paratyphi A (strain AKU_12601)
A9MZ19 1.98e-87 255 77 0 151 3 rnhA Ribonuclease H Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PFD8 1.98e-87 255 77 0 151 3 rnhA Ribonuclease H Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SV39 1.98e-87 255 77 0 151 3 rnhA Ribonuclease H Salmonella newport (strain SL254)
B4TK85 1.98e-87 255 77 0 151 3 rnhA Ribonuclease H Salmonella heidelberg (strain SL476)
B5R5L3 1.98e-87 255 77 0 151 3 rnhA Ribonuclease H Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R449 1.98e-87 255 77 0 151 3 rnhA Ribonuclease H Salmonella enteritidis PT4 (strain P125109)
B5FJ58 1.98e-87 255 77 0 151 3 rnhA Ribonuclease H Salmonella dublin (strain CT_02021853)
Q57SZ6 1.98e-87 255 77 0 151 3 rnhA Ribonuclease H Salmonella choleraesuis (strain SC-B67)
A9MPF1 1.98e-87 255 77 0 151 3 rnhA Ribonuclease H Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F8X2 1.98e-87 255 77 0 151 3 rnhA Ribonuclease H Salmonella agona (strain SL483)
A7MI34 3.44e-87 254 76 0 151 3 rnhA Ribonuclease H Cronobacter sakazakii (strain ATCC BAA-894)
C0Q6N2 5.27e-87 254 77 0 151 3 rnhA Ribonuclease H Salmonella paratyphi C (strain RKS4594)
A8GA77 3.36e-86 252 75 0 151 3 rnhA Ribonuclease H Serratia proteamaculans (strain 568)
B7VIP1 5.04e-86 251 72 0 154 3 rnhA Ribonuclease H Vibrio atlanticus (strain LGP32)
Q0TLC3 1.05e-85 251 76 0 151 3 rnhA Ribonuclease H Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7UJB0 1.05e-85 251 76 0 151 3 rnhA Ribonuclease H Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A4W6V4 1.48e-85 250 75 0 151 3 rnhA Ribonuclease H Enterobacter sp. (strain 638)
A6T512 3.29e-85 249 75 0 152 3 rnhA Ribonuclease H Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
A7ZWF6 3.63e-85 249 76 0 151 3 rnhA Ribonuclease H Escherichia coli O9:H4 (strain HS)
B7LHC0 3.63e-85 249 76 0 151 3 rnhA Ribonuclease H Escherichia coli (strain 55989 / EAEC)
A7MY21 4.27e-85 249 72 0 154 3 rnhA Ribonuclease H Vibrio campbellii (strain ATCC BAA-1116)
C6DC65 4.98e-85 249 74 0 151 3 rnhA Ribonuclease H Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B5Y1G2 6.49e-85 249 74 0 151 3 rnhA Ribonuclease H Klebsiella pneumoniae (strain 342)
Q87MG2 1.18e-84 248 72 0 154 3 rnhA Ribonuclease HI Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q3Z5E9 1.34e-84 248 76 0 151 3 rnhA Ribonuclease H Shigella sonnei (strain Ss046)
P0A7Y7 1.34e-84 248 76 0 151 3 rnhA Ribonuclease HI Shigella flexneri
Q32JP9 1.34e-84 248 76 0 151 3 rnhA Ribonuclease H Shigella dysenteriae serotype 1 (strain Sd197)
Q325T2 1.34e-84 248 76 0 151 3 rnhA Ribonuclease H Shigella boydii serotype 4 (strain Sb227)
B2U352 1.34e-84 248 76 0 151 3 rnhA Ribonuclease H Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LW89 1.34e-84 248 76 0 151 3 rnhA Ribonuclease H Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LHM3 1.34e-84 248 76 0 151 3 rnhA Ribonuclease H Escherichia coli (strain SMS-3-5 / SECEC)
B6HZS7 1.34e-84 248 76 0 151 3 rnhA Ribonuclease H Escherichia coli (strain SE11)
B7N876 1.34e-84 248 76 0 151 3 rnhA Ribonuclease H Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7Y4 1.34e-84 248 76 0 151 1 rnhA Ribonuclease HI Escherichia coli (strain K12)
B1IPU4 1.34e-84 248 76 0 151 3 rnhA Ribonuclease H Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7Y5 1.34e-84 248 76 0 151 3 rnhA Ribonuclease HI Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B1XD78 1.34e-84 248 76 0 151 3 rnhA Ribonuclease H Escherichia coli (strain K12 / DH10B)
C4ZRV1 1.34e-84 248 76 0 151 3 rnhA Ribonuclease H Escherichia coli (strain K12 / MC4100 / BW2952)
B7M213 1.34e-84 248 76 0 151 3 rnhA Ribonuclease H Escherichia coli O8 (strain IAI1)
B7MQ23 1.34e-84 248 76 0 151 3 rnhA Ribonuclease H Escherichia coli O81 (strain ED1a)
B7NKW4 1.34e-84 248 76 0 151 3 rnhA Ribonuclease H Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z0I8 1.34e-84 248 76 0 151 3 rnhA Ribonuclease H Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7Y6 1.34e-84 248 76 0 151 3 rnhA Ribonuclease HI Escherichia coli O157:H7
B7MBJ0 1.34e-84 248 76 0 151 3 rnhA Ribonuclease H Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZHV1 1.34e-84 248 76 0 151 3 rnhA Ribonuclease H Escherichia coli O139:H28 (strain E24377A / ETEC)
C5BEV5 1.49e-83 245 72 0 151 3 rnhA Ribonuclease H Edwardsiella ictaluri (strain 93-146)
Q7MII6 1.53e-83 245 72 0 151 3 rnhA Ribonuclease H Vibrio vulnificus (strain YJ016)
Q8DBD5 1.53e-83 245 72 0 151 3 rnhA Ribonuclease HI Vibrio vulnificus (strain CMCP6)
B2VHJ5 1.74e-83 245 73 0 151 3 rnhA Ribonuclease H Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q5E3G5 1.9e-83 245 72 0 151 3 rnhA Ribonuclease H Aliivibrio fischeri (strain ATCC 700601 / ES114)
C3LPN8 4.18e-82 241 70 0 151 3 rnhA Ribonuclease H Vibrio cholerae serotype O1 (strain M66-2)
Q9KPX8 4.18e-82 241 70 0 151 3 rnhA Ribonuclease HI Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F633 4.18e-82 241 70 0 151 3 rnhA Ribonuclease H Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B6EJV2 1.94e-81 240 70 0 151 3 rnhA Ribonuclease H Aliivibrio salmonicida (strain LFI1238)
B1KHK0 2.68e-81 239 70 1 153 3 rnhA Ribonuclease H Shewanella woodyi (strain ATCC 51908 / MS32)
Q2NVF9 3.26e-81 239 71 1 156 3 rnhA Ribonuclease H Sodalis glossinidius (strain morsitans)
A8FUS8 2.91e-78 232 69 1 150 3 rnhA Ribonuclease H Shewanella sediminis (strain HAW-EB3)
A0KXS6 8.33e-78 231 69 1 150 3 rnhA Ribonuclease H Shewanella sp. (strain ANA-3)
Q8EE30 1.21e-77 230 69 1 150 1 rnhA Ribonuclease HI Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q0HI86 2.6e-77 229 69 1 150 3 rnhA Ribonuclease H Shewanella sp. (strain MR-4)
Q0HUI2 2.75e-77 229 69 1 150 3 rnhA Ribonuclease H Shewanella sp. (strain MR-7)
B0TRM1 9.09e-77 228 64 1 154 3 rnhA Ribonuclease H Shewanella halifaxensis (strain HAW-EB4)
A1SS86 9.79e-77 228 68 1 150 3 rnhA Ribonuclease H Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q12MM4 2.57e-76 227 65 1 154 3 rnhA Ribonuclease H Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A3QET0 2.13e-75 224 68 2 154 3 rnhA Ribonuclease H Shewanella loihica (strain ATCC BAA-1088 / PV-4)
P43807 2.68e-75 224 67 0 153 3 rnhA Ribonuclease HI Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A1S6T0 2.71e-75 224 66 1 150 3 rnhA Ribonuclease H Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A5UFU3 6.95e-75 223 66 0 153 3 rnhA Ribonuclease H Haemophilus influenzae (strain PittGG)
Q4QP49 6.95e-75 223 66 0 153 3 rnhA Ribonuclease H Haemophilus influenzae (strain 86-028NP)
A9L0F2 9.25e-75 223 66 1 150 3 rnhA Ribonuclease H Shewanella baltica (strain OS195)
A6WMW8 9.25e-75 223 66 1 150 3 rnhA Ribonuclease H Shewanella baltica (strain OS185)
A3D440 9.25e-75 223 66 1 150 3 rnhA Ribonuclease H Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E599 9.25e-75 223 66 1 150 3 rnhA Ribonuclease H Shewanella baltica (strain OS223)
P57813 5.22e-74 221 64 0 151 3 rnhA Ribonuclease HI Pasteurella multocida (strain Pm70)
A1RK75 1.76e-73 220 64 1 150 3 rnhA Ribonuclease H Shewanella sp. (strain W3-18-1)
A4Y6C1 1.76e-73 220 64 1 150 3 rnhA Ribonuclease H Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
C4LC60 1.43e-72 217 63 1 152 3 rnhA Ribonuclease H Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A6VMP9 3.96e-72 216 66 0 151 3 rnhA Ribonuclease H Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q65S82 4.66e-72 216 63 0 151 3 rnhA Ribonuclease H Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q081L4 5.55e-71 213 64 1 150 3 rnhA Ribonuclease H Shewanella frigidimarina (strain NCIMB 400)
A0KIK4 2.02e-70 212 63 1 152 3 rnhA Ribonuclease H Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4SPI4 7.12e-70 211 63 1 152 3 rnhA Ribonuclease H Aeromonas salmonicida (strain A449)
A3MZE1 8.19e-69 208 64 0 149 3 rnhA Ribonuclease H Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q15TA7 1.56e-68 207 64 0 143 3 rnhA Ribonuclease H Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q493H7 1.69e-68 207 62 1 149 3 rnhA Ribonuclease H Blochmanniella pennsylvanica (strain BPEN)
Q1LT02 3.63e-68 206 60 0 151 3 rnhA Ribonuclease H Baumannia cicadellinicola subsp. Homalodisca coagulata
Q7VM15 9.49e-67 202 62 0 149 3 rnhA Ribonuclease HI Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q3IIS1 2.23e-66 202 62 1 152 3 rnhA Ribonuclease H Pseudoalteromonas translucida (strain TAC 125)
Q1QH30 9.89e-66 200 68 0 135 3 rnhA Ribonuclease H Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q7VQB6 2.12e-65 200 60 1 149 3 rnhA Ribonuclease H Blochmanniella floridana
Q5QZL3 2.12e-65 199 57 1 150 3 rnhA Ribonuclease H Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q3SP51 1.12e-64 197 67 0 135 3 rnhA Ribonuclease H Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
B6JJ39 3.48e-64 196 69 0 134 3 rnhA Ribonuclease H Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q89UU3 6.13e-64 196 66 0 134 3 rnhA Ribonuclease H Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q985W1 8.7e-64 196 66 0 138 3 rnhA Ribonuclease H Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A4Z216 1.35e-63 194 67 0 134 3 rnhA Ribonuclease H Bradyrhizobium sp. (strain ORS 278)
Q2J0F8 5.16e-63 193 64 0 136 3 rnhA Ribonuclease H Rhodopseudomonas palustris (strain HaA2)
Q131J2 5.36e-63 193 65 0 136 3 rnhA Ribonuclease H Rhodopseudomonas palustris (strain BisB5)
A5EAL2 7.85e-63 192 65 0 134 3 rnhA Ribonuclease H Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A1WXD7 1.35e-62 192 64 0 134 3 rnhA Ribonuclease H Halorhodospira halophila (strain DSM 244 / SL1)
Q3J7D4 1.36e-62 192 62 0 140 3 rnhA Ribonuclease H Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q8UHA7 2.3e-62 191 66 0 136 3 rnhA Ribonuclease H Agrobacterium fabrum (strain C58 / ATCC 33970)
P59434 5.16e-62 191 53 0 152 3 rnhA Ribonuclease H Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q11KC5 6.19e-62 191 57 0 157 3 rnhA Ribonuclease H Chelativorans sp. (strain BNC1)
B3Q6U1 1.37e-61 189 65 0 136 3 rnhA Ribonuclease H Rhodopseudomonas palustris (strain TIE-1)
Q6N1Y3 1.37e-61 189 65 0 136 3 rnhA Ribonuclease H Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q0VQ76 3.04e-61 189 64 0 135 3 rnhA Ribonuclease H Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q92RG0 5.2e-61 188 63 0 136 3 rnhA Ribonuclease H Rhizobium meliloti (strain 1021)
Q31H49 5.7e-61 187 60 0 143 3 rnhA Ribonuclease H Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A6U6V5 5.8e-61 188 62 0 136 3 rnhA Ribonuclease H Sinorhizobium medicae (strain WSM419)
Q0A753 3.28e-60 186 64 0 131 3 rnhA Ribonuclease H Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
B0T025 3.56e-60 186 62 0 138 3 rnhA Ribonuclease H Caulobacter sp. (strain K31)
B4R8T3 5.84e-60 185 64 0 138 3 rnhA Ribonuclease H Phenylobacterium zucineum (strain HLK1)
Q1MKH6 7.6e-60 185 63 0 136 3 rnhA Ribonuclease H Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q2KBL2 1.18e-59 184 62 0 136 3 rnhA Ribonuclease H Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q2Y8K1 2.36e-59 184 60 0 142 3 rnhA Ribonuclease H Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q08885 2.6e-59 184 56 0 151 3 rnhA Ribonuclease H Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q1QW64 2.8e-59 184 61 0 137 3 rnhA Ribonuclease H Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q5NYP6 5.56e-59 183 62 0 138 3 rnhA Ribonuclease H Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q7WCJ8 1.02e-58 182 56 0 141 3 rnhA Ribonuclease H Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
A9IQR5 1.09e-58 182 62 0 138 3 rnhA Ribonuclease H Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q7VRX8 1.35e-58 182 56 0 141 3 rnhA Ribonuclease H Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
A1VFS4 1.91e-58 182 57 2 149 3 rnhA Ribonuclease H Nitratidesulfovibrio vulgaris (strain DP4)
Q72E89 1.91e-58 182 57 2 149 3 rnhA Ribonuclease H Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
P66674 2.11e-58 181 58 0 140 3 rnhA Ribonuclease HI Brucella suis biovar 1 (strain 1330)
B0CKG2 2.11e-58 181 58 0 140 3 rnhA Ribonuclease H Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VP47 2.11e-58 181 58 0 140 3 rnhA Ribonuclease H Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P66673 2.11e-58 181 58 0 140 3 rnhA Ribonuclease HI Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q57EP4 2.11e-58 181 58 0 140 3 rnhA Ribonuclease H Brucella abortus biovar 1 (strain 9-941)
Q2YMI3 2.11e-58 181 58 0 140 3 rnhA Ribonuclease H Brucella abortus (strain 2308)
A1URX4 6.37e-58 180 60 0 138 3 rnhA Ribonuclease H Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q2G9E3 6.79e-58 180 61 0 139 3 rnhA Ribonuclease H Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q3A827 7.6e-58 180 59 0 136 3 rnhA Ribonuclease H Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
B8DIU7 1.09e-57 180 55 2 153 3 rnhA Ribonuclease H Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
Q2W9A9 1.09e-57 180 59 0 134 3 rnhA Ribonuclease H Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q2ND39 1.1e-57 179 63 0 139 3 rnhA Ribonuclease H Erythrobacter litoralis (strain HTCC2594)
A1B840 1.45e-57 179 60 1 138 3 rnhA Ribonuclease H Paracoccus denitrificans (strain Pd 1222)
Q5H426 2.62e-57 179 58 0 141 3 rnhA Ribonuclease H Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P6Y2 2.62e-57 179 58 0 141 3 rnhA Ribonuclease H Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q7NYL8 2.72e-57 178 58 1 141 3 rnhA Ribonuclease H Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A6WWG8 2.76e-57 179 60 0 136 3 rnhA Ribonuclease H Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q74BH0 3.45e-57 178 56 0 147 3 rnhA Ribonuclease H Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A1AT66 5.16e-57 178 58 0 136 3 rnhA Ribonuclease H Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
A0LGJ7 6.27e-57 178 57 0 147 3 rnhA Ribonuclease H Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q8PNH8 7.41e-57 177 58 0 139 3 rnhA Ribonuclease H Xanthomonas axonopodis pv. citri (strain 306)
A9KGQ0 1.25e-56 177 58 0 133 3 rnhA Ribonuclease H Coxiella burnetii (strain Dugway 5J108-111)
B6J1Y7 1.25e-56 177 58 0 133 3 rnhA Ribonuclease H Coxiella burnetii (strain CbuG_Q212)
B6J5V1 1.28e-56 177 58 0 133 3 rnhA Ribonuclease H Coxiella burnetii (strain CbuK_Q154)
Q3BWP3 1.35e-56 177 58 0 139 3 rnhA Ribonuclease H Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B8H4W7 1.35e-56 177 62 0 137 3 rnhA Ribonuclease H Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A341 1.35e-56 177 62 0 137 3 rnhA Ribonuclease HI Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q83EK3 1.36e-56 177 58 0 133 3 rnhA Ribonuclease H Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NB52 1.36e-56 177 58 0 133 3 rnhA Ribonuclease H Coxiella burnetii (strain RSA 331 / Henzerling II)
Q8PBX8 1.61e-56 177 58 0 139 3 rnhA Ribonuclease H Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4URM3 1.61e-56 177 58 0 139 3 rnhA Ribonuclease H Xanthomonas campestris pv. campestris (strain 8004)
Q1LL89 2.8e-56 176 57 0 141 3 rnhA Ribonuclease H Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A1W6Q8 4.72e-56 175 60 1 141 3 rnhA Ribonuclease H Acidovorax sp. (strain JS42)
Q2SJ45 4.77e-56 175 57 0 145 3 rnhA Ribonuclease H Hahella chejuensis (strain KCTC 2396)
Q2RPU6 4.99e-56 176 59 0 135 3 rnhA Ribonuclease H Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
A4J7B3 5.15e-56 176 56 1 144 3 rnhA Ribonuclease H Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q9PBI6 5.99e-56 175 57 0 141 3 rnhA Ribonuclease HI Xylella fastidiosa (strain 9a5c)
Q87C76 7.96e-56 175 58 0 141 3 rnhA Ribonuclease HI Xylella fastidiosa (strain Temecula1 / ATCC 700964)
A1WFG9 9.64e-56 175 59 1 138 3 rnhA Ribonuclease H Verminephrobacter eiseniae (strain EF01-2)
A3PMR3 9.68e-56 175 56 1 138 3 rnhA Ribonuclease H Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q48KX6 1e-55 174 58 0 137 3 rnhA Ribonuclease H Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q1H190 1.29e-55 174 59 0 133 3 rnhA Ribonuclease H Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A4WNV1 1.37e-55 174 56 1 138 3 rnhA Ribonuclease H Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q47FN9 1.73e-55 174 62 0 133 3 rnhA Ribonuclease H Dechloromonas aromatica (strain RCB)
A7HQX4 1.97e-55 174 58 0 134 3 rnhA Ribonuclease H Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q1GDG1 5.71e-55 173 60 1 138 3 rnhA Ribonuclease H Ruegeria sp. (strain TM1040)
Q0AMI4 8.27e-55 172 62 1 135 3 rnhA Ribonuclease H Maricaulis maris (strain MCS10)
Q9JYE5 9.07e-55 172 55 1 143 3 rnhA Ribonuclease HI Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q87YT0 1.1e-54 172 58 0 137 3 rnhA Ribonuclease HI Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q60AW8 1.15e-54 172 56 0 133 3 rnhA Ribonuclease H Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q3KE77 1.19e-54 172 60 0 133 3 rnhA Ribonuclease H Pseudomonas fluorescens (strain Pf0-1)
A4XU11 1.4e-54 172 57 0 134 3 rnhA Ribonuclease H Pseudomonas mendocina (strain ymp)
Q9JTD9 1.67e-54 171 55 1 143 3 rnhA Ribonuclease HI Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q5ZVQ7 1.73e-54 171 56 0 139 3 rnhA Ribonuclease H Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IBM5 1.73e-54 171 56 0 139 3 rnhA Ribonuclease H Legionella pneumophila (strain Corby)
Q5X5I2 1.73e-54 171 56 0 139 3 rnhA Ribonuclease H Legionella pneumophila (strain Paris)
A4VLR0 1.87e-54 171 59 0 133 3 rnhA Ribonuclease H Stutzerimonas stutzeri (strain A1501)
A5EXP9 1.94e-54 171 56 0 139 3 rnhA Ribonuclease H Dichelobacter nodosus (strain VCS1703A)
Q4ZVL1 1.96e-54 171 58 0 137 3 rnhA Ribonuclease H Pseudomonas syringae pv. syringae (strain B728a)
Q2LWY9 2.5e-54 172 54 2 152 3 rnhA Ribonuclease H Syntrophus aciditrophicus (strain SB)
Q5WWW5 2.51e-54 171 56 0 139 3 rnhA Ribonuclease H Legionella pneumophila (strain Lens)
A1TQI7 3.04e-54 171 61 1 136 3 rnhA Ribonuclease H Paracidovorax citrulli (strain AAC00-1)
O69014 3.25e-54 171 59 0 139 3 rnhA Ribonuclease H Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q0RJ31 5.86e-54 170 57 1 139 3 rnhA Ribonuclease H Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q5LNJ2 6.42e-54 170 58 1 140 3 rnhA Ribonuclease H Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q01RW8 7.48e-54 170 54 0 144 3 rnhA Ribonuclease H Solibacter usitatus (strain Ellin6076)
B1JBN1 8.41e-54 170 56 0 137 3 rnhA Ribonuclease H Pseudomonas putida (strain W619)
Q6G0C8 8.62e-54 170 53 1 152 3 rnhA Ribonuclease H Bartonella quintana (strain Toulouse)
A1U0U9 8.8e-54 169 55 0 137 3 rnhA Ribonuclease H Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q88FF5 1.5e-53 169 56 0 137 3 rnhA Ribonuclease HI Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KN00 1.5e-53 169 56 0 137 3 rnhA Ribonuclease H Pseudomonas putida (strain GB-1)
A5W169 1.5e-53 169 56 0 137 3 rnhA Ribonuclease H Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q28V43 1.97e-53 169 55 1 138 3 rnhA Ribonuclease H Jannaschia sp. (strain CCS1)
Q0C3M1 2.2e-53 169 58 0 134 3 rnhA Ribonuclease H Hyphomonas neptunium (strain ATCC 15444)
Q8XZ91 2.42e-53 169 53 0 140 3 rnhA Ribonuclease H Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q4KBI1 2.65e-53 168 57 0 137 3 rnhA Ribonuclease H Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A8LLC1 3.16e-53 169 58 1 136 3 rnhA Ribonuclease H Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q16AK0 3.55e-53 168 57 1 138 3 rnhA Ribonuclease H Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q1I7T4 3.8e-53 168 56 0 137 3 rnhA Ribonuclease H Pseudomonas entomophila (strain L48)
A1KV38 5.02e-53 167 54 1 143 3 rnhA Ribonuclease H Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
A4G7G3 5.47e-53 167 55 0 141 3 rnhA Ribonuclease H Herminiimonas arsenicoxydans
A6V705 1.2e-52 167 55 1 143 3 rnhA Ribonuclease H Pseudomonas aeruginosa (strain PA7)
Q9I2S9 1.65e-52 166 55 1 143 3 rnhA Ribonuclease HI Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02KV8 1.65e-52 166 55 1 143 3 rnhA Ribonuclease H Pseudomonas aeruginosa (strain UCBPP-PA14)
B7VB62 1.65e-52 166 55 1 143 3 rnhA Ribonuclease H Pseudomonas aeruginosa (strain LESB58)
Q12B88 1.68e-52 167 57 1 140 3 rnhA Ribonuclease H Polaromonas sp. (strain JS666 / ATCC BAA-500)
A5G5F6 2.79e-52 166 56 0 139 3 rnhA Ribonuclease H Geotalea uraniireducens (strain Rf4)
Q72IE1 9.02e-52 165 55 1 145 3 rnhA Ribonuclease H Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
P29253 1.01e-51 165 55 1 145 1 rnhA Ribonuclease H Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q6G4C3 1.1e-51 164 54 1 142 3 rnhA Ribonuclease H Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A4SXM6 1.17e-51 164 53 0 141 3 rnhA Ribonuclease H Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A6SXA4 1.28e-51 164 55 0 134 3 rnhA Ribonuclease H Janthinobacterium sp. (strain Marseille)
Q30X61 1.81e-51 164 57 1 140 3 rnhA Ribonuclease H Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q5F7K9 2.04e-51 164 53 1 143 3 rnhA Ribonuclease H Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A1VMW5 2.65e-51 164 55 1 142 3 rnhA Ribonuclease H Polaromonas naphthalenivorans (strain CJ2)
Q2KV56 3.13e-51 163 52 0 139 3 rnhA Ribonuclease H Bordetella avium (strain 197N)
Q46Z81 4.49e-51 162 53 0 141 3 rnhA Ribonuclease H Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q0AE34 1.26e-50 162 53 1 148 3 rnhA Ribonuclease H Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q1CTK9 1.62e-50 161 57 1 147 3 rnhA Ribonuclease H Helicobacter pylori (strain HPAG1)
Q0K8W6 1.96e-50 161 52 0 141 3 rnhA Ribonuclease H Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P56120 4.42e-50 160 55 1 147 3 rnhA Ribonuclease HI Helicobacter pylori (strain ATCC 700392 / 26695)
B7JVG1 5.5e-50 160 53 1 141 3 rnhA Ribonuclease H Rippkaea orientalis (strain PCC 8801 / RF-1)
Q82XV8 9.03e-50 160 53 2 151 3 rnhA Ribonuclease H Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q9ZLH3 2.06e-49 158 55 1 147 3 rnhA Ribonuclease HI Helicobacter pylori (strain J99 / ATCC 700824)
Q21YF6 4.25e-49 158 55 1 135 3 rnhA Ribonuclease H Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q5PBQ8 5.13e-49 158 52 1 140 3 rnhA Ribonuclease H Anaplasma marginale (strain St. Maries)
Q3SIB2 5.41e-49 157 54 0 133 3 rnhA Ribonuclease H Thiobacillus denitrificans (strain ATCC 25259)
Q07705 6.33e-49 157 54 1 139 3 rnhA Ribonuclease H Mycolicibacterium smegmatis
A0R3Q8 6.33e-49 157 54 1 139 3 rnhA Ribonuclease H Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A4FMU3 3.17e-48 155 54 2 135 3 rnhA Ribonuclease H Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q8D3D3 5.05e-48 155 47 0 151 3 rnhA Ribonuclease H Wigglesworthia glossinidia brevipalpis
Q7UF86 1.14e-47 154 52 2 145 3 rnhA Ribonuclease H Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
A9KLJ9 1.29e-47 154 50 3 157 3 rnhA Ribonuclease H Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
A4T6Y5 1.64e-47 154 53 1 143 3 rnhA Ribonuclease H Mycolicibacterium gilvum (strain PYR-GCK)
Q17XJ7 5.08e-47 152 54 1 147 3 rnhA Ribonuclease H Helicobacter acinonychis (strain Sheeba)
Q5FG88 5.52e-47 152 52 0 136 3 rnhA Ribonuclease H Ehrlichia ruminantium (strain Gardel)
Q115G0 1.12e-46 152 46 2 150 3 rnhA Ribonuclease H Trichodesmium erythraeum (strain IMS101)
A5CEP5 1.25e-46 152 53 0 133 3 rnhA Ribonuclease H Orientia tsutsugamushi (strain Boryong)
Q0BQX7 1.26e-46 151 60 0 136 3 rnhA Ribonuclease H Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
C0R2X2 3.1e-46 150 50 0 138 3 rnhA Ribonuclease H Wolbachia sp. subsp. Drosophila simulans (strain wRi)
Q67K93 5.7e-46 150 50 1 145 3 rnhA Ribonuclease H Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q73I74 6.52e-46 149 50 0 138 3 rnhA Ribonuclease H Wolbachia pipientis wMel
B0TZ91 8.73e-46 149 50 0 142 3 rnhA Ribonuclease H Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A8GPT6 4.74e-45 147 48 0 137 3 rnhA Ribonuclease H Rickettsia akari (strain Hartford)
Q1RJL7 7.45e-45 147 48 0 140 3 rnhA Ribonuclease H Rickettsia bellii (strain RML369-C)
A4SFZ9 1.15e-44 146 48 1 143 3 rnhA Ribonuclease H Chlorobium phaeovibrioides (strain DSM 265 / 1930)
A8F2L0 1.19e-44 147 49 0 137 3 rnhA Ribonuclease H Rickettsia massiliae (strain Mtu5)
Q92GL5 1.29e-44 146 49 0 137 3 rnhA Ribonuclease HI Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q4UN27 1.68e-44 146 48 0 137 3 rnhA Ribonuclease H Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
A4IYE6 2.36e-44 146 50 0 137 3 rnhA Ribonuclease H Francisella tularensis subsp. tularensis (strain WY96-3418)
Q0BMB7 2.36e-44 146 50 0 137 3 rnhA Ribonuclease H Francisella tularensis subsp. holarctica (strain OSU18)
A0Q6W0 2.36e-44 146 50 0 137 3 rnhA Ribonuclease H Francisella tularensis subsp. novicida (strain U112)
B2SFV9 2.36e-44 146 50 0 137 3 rnhA Ribonuclease H Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A3X6 2.36e-44 146 50 0 137 3 rnhA Ribonuclease H Francisella tularensis subsp. holarctica (strain LVS)
A7NBM9 2.36e-44 146 50 0 137 3 rnhA Ribonuclease H Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14IN1 2.36e-44 146 50 0 137 3 rnhA Ribonuclease H Francisella tularensis subsp. tularensis (strain FSC 198)
Q39X47 2.72e-44 145 52 0 150 3 rnhA Ribonuclease H Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q3YR62 4.31e-44 145 50 0 136 3 rnhA Ribonuclease H Ehrlichia canis (strain Jake)
B5EMD8 5.94e-44 145 45 1 155 3 rnhA Ribonuclease H Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J4E2 5.94e-44 145 45 1 155 3 rnhA Ribonuclease H Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
B3EMT1 8.29e-44 144 48 1 144 3 rnhA Ribonuclease H Chlorobium phaeobacteroides (strain BS1)
Q68W20 1.64e-43 144 48 0 137 3 rnhA Ribonuclease H Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q5FUH9 1.69e-43 144 58 0 134 3 rnhA Ribonuclease H Gluconobacter oxydans (strain 621H)
A8EXT7 4.12e-43 143 46 0 141 3 rnhA Ribonuclease H Rickettsia canadensis (strain McKiel)
A5FZ26 4.9e-43 143 53 0 143 3 rnhA Ribonuclease H Acidiphilium cryptum (strain JF-5)
B3QM41 5.59e-43 142 48 1 141 3 rnhA Ribonuclease H Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
A3DD79 6.16e-43 142 47 1 146 3 rnhA Ribonuclease H Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
A8Z6F7 7.8e-43 142 49 1 139 3 rnhA Ribonuclease H Campylobacter concisus (strain 13826)
Q3APT0 7.93e-43 142 48 1 141 3 rnhA Ribonuclease H Chlorobium chlorochromatii (strain CaD3)
Q9ZCK3 8.63e-43 142 47 0 137 3 rnhA Ribonuclease HI Rickettsia prowazekii (strain Madrid E)
Q2GHJ9 1.76e-42 141 47 0 136 3 rnhA Ribonuclease H Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
Q5HSF7 2.44e-42 140 48 3 149 3 rnhA Ribonuclease H Campylobacter jejuni (strain RM1221)
A1W1N8 2.44e-42 140 48 3 149 3 rnhA Ribonuclease H Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PM39 2.44e-42 140 48 3 149 3 rnhA Ribonuclease HI Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FNU8 2.44e-42 140 48 3 149 3 rnhA Ribonuclease H Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q55801 3.89e-42 140 46 3 150 3 rnhA Ribonuclease HI Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B0K1A7 4.59e-42 140 47 1 145 3 rnhA Ribonuclease H Thermoanaerobacter sp. (strain X514)
B0K9M0 4.59e-42 140 47 1 145 3 rnhA Ribonuclease H Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q8RA67 4.82e-42 140 48 1 145 3 rnhA Ribonuclease H Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A1AW38 6.8e-42 139 49 1 138 3 rnhA Ribonuclease H Ruthia magnifica subsp. Calyptogena magnifica
Q3B2H0 9.64e-42 139 48 1 143 3 rnhA Ribonuclease H Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
B4S5K2 8.54e-41 137 45 1 144 3 rnhA Ribonuclease H Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q2RKU0 1.37e-40 136 49 2 137 3 rnhA Ribonuclease H Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
A1BE10 3.19e-40 135 45 1 144 3 rnhA Ribonuclease H Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
A7H185 3.98e-40 135 44 0 139 3 rnhA Ribonuclease H Campylobacter curvus (strain 525.92)
B3EH35 8.25e-40 134 45 1 144 3 rnhA Ribonuclease H Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
A7GAG3 1.96e-39 133 46 2 142 3 rnhA Ribonuclease H Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
A5HYU6 1.96e-39 133 46 2 142 3 rnhA Ribonuclease H Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FR34 1.96e-39 133 46 2 142 3 rnhA Ribonuclease H Clostridium botulinum (strain ATCC 19397 / Type A)
B2S2V0 1.25e-38 132 44 2 156 3 rnhA Ribonuclease H Treponema pallidum subsp. pallidum (strain SS14)
O83372 1.25e-38 132 44 2 156 3 rnhA Ribonuclease H Treponema pallidum (strain Nichols)
B8HPS9 1.48e-38 131 46 5 142 3 rnhA Ribonuclease H Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Q8DM24 1.5e-38 131 52 4 138 3 rnhA Ribonuclease H Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q73K21 1.96e-38 131 44 2 156 3 rnhA Ribonuclease H Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
A4XKQ3 7.45e-38 129 45 1 141 3 rnhA Ribonuclease H Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
A5CX29 1.29e-37 129 46 1 141 3 rnhA Ribonuclease H Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q46HH3 9.02e-37 127 48 3 135 3 rnhA Ribonuclease H Prochlorococcus marinus (strain NATL2A)
A2C030 9.52e-37 127 48 3 135 3 rnhA Ribonuclease H Prochlorococcus marinus (strain NATL1A)
Q2GDA1 5.33e-36 124 46 2 141 3 rnhA Ribonuclease H Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
Q0AV47 9.65e-36 124 44 2 143 3 rnhA Ribonuclease H Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
A9W185 1.31e-35 126 46 1 131 3 rnhA Ribonuclease H Methylorubrum extorquens (strain PA1)
A7HB50 1.02e-31 114 41 3 147 3 rnhA Ribonuclease H Anaeromyxobacter sp. (strain Fw109-5)
A6QCI9 1.45e-31 113 49 1 140 3 rnhA Ribonuclease H Sulfurovum sp. (strain NBC37-1)
B4UMK8 9.4e-31 112 41 2 143 3 rnhA Ribonuclease H Anaeromyxobacter sp. (strain K)
B8J731 1.24e-30 112 41 2 143 3 rnhA Ribonuclease H Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q7VDY9 2.84e-30 110 44 3 133 3 rnhA Ribonuclease H Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q2IJL8 5.24e-30 110 40 2 144 3 rnhA Ribonuclease H Anaeromyxobacter dehalogenans (strain 2CP-C)
Q83GM3 1.49e-27 103 39 2 143 3 rnhA Ribonuclease H Tropheryma whipplei (strain Twist)
Q83HK9 1.49e-27 103 39 2 143 3 rnhA Ribonuclease H Tropheryma whipplei (strain TW08/27)
Q5BK46 3.12e-16 76 32 2 147 2 Rnaseh1 Ribonuclease H1 Rattus norvegicus
O70338 4.75e-16 76 32 2 147 2 Rnaseh1 Ribonuclease H1 Mus musculus
O60930 1.42e-14 72 32 2 147 1 RNASEH1 Ribonuclease H1 Homo sapiens
Q9UST8 2.2e-13 68 30 3 143 1 rnh1 Ribonuclease H Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9X7R6 3.41e-13 67 28 3 146 3 rnhA Ribonuclease HI Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q5UPY1 3.21e-09 57 27 2 115 3 RNH1 Probable ribonuclease H Acanthamoeba polyphaga mimivirus
Q07762 7.25e-07 51 27 5 158 3 RNH1 Ribonuclease H Crithidia fasciculata
Q04740 1.62e-06 50 28 6 163 1 RNH1 Ribonuclease H Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q82851 1.95e-05 47 26 4 138 3 gag-pol Gag-Pol polyprotein Jembrana disease virus
P14350 0.000149 44 27 2 111 1 pol Pro-Pol polyprotein Human spumaretrovirus
P54162 0.000212 42 27 5 137 1 rnhA 14.7 kDa ribonuclease H-like protein Bacillus subtilis (strain 168)
Q87040 0.000377 43 26 5 146 3 pol Pro-Pol polyprotein Simian foamy virus (isolate chimpanzee)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS01095
Feature type CDS
Gene rnhA
Product ribonuclease HI
Location 270701 - 271180 (strand: -1)
Length 480 (nucleotides) / 159 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1865
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00075 RNase H

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0328 Replication, recombination and repair (L) L Ribonuclease HI

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03469 ribonuclease HI [EC:3.1.26.4] DNA replication -

Protein Sequence

MHKQVEIFTDGSCLGNPGPGGYGAILRYQQHEKTLSEGFFMTTNNRMELLAAIVALEALKFPCKITLTTDSQYVRQGITKWIHSWKKRQWRKADKSPVLNVDLWKRLDKAIERHEIEWHWVKGHAGHDENERCDELAKAAAQSPTKEDTGYLESQQDKT

Flanking regions ( +/- flanking 50bp)

CAGACTTAGGGTTAATTTTTCGTATTACTTAAAAAGGATAAGTCGCCTTTATGCACAAGCAGGTAGAAATATTCACCGATGGTTCATGTTTAGGCAACCCAGGTCCTGGTGGTTATGGTGCAATTTTACGCTACCAACAGCATGAAAAAACCCTTAGTGAAGGTTTTTTTATGACCACCAATAACCGCATGGAACTCCTTGCTGCTATCGTAGCATTAGAAGCGTTAAAATTCCCTTGTAAAATTACACTGACTACGGATAGCCAGTATGTCAGACAGGGAATTACCAAGTGGATACATAGTTGGAAAAAACGCCAATGGCGTAAAGCAGATAAAAGCCCTGTGCTGAATGTTGATTTATGGAAGCGTCTTGATAAAGCCATTGAGCGTCATGAAATTGAATGGCATTGGGTTAAAGGTCATGCAGGCCATGACGAAAATGAACGTTGTGATGAACTGGCCAAAGCGGCCGCGCAATCTCCCACAAAAGAAGATACTGGCTATCTAGAAAGTCAACAAGATAAAACCTGAGAGTAATAACGGCAGATAGTGATATTAATCAGGTCGATTACGTGTAGCGC