Homologs in group_1865

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
EHELCC_11615 EHELCC_11615 100.0 Morganella morganii S2 rnhA ribonuclease HI
NLDBIP_11960 NLDBIP_11960 100.0 Morganella morganii S4 rnhA ribonuclease HI
LHKJJB_11820 LHKJJB_11820 100.0 Morganella morganii S3 rnhA ribonuclease HI
HKOGLL_10430 HKOGLL_10430 100.0 Morganella morganii S5 rnhA ribonuclease HI
F4V73_RS12800 F4V73_RS12800 90.3 Morganella psychrotolerans rnhA ribonuclease HI
PMI_RS01095 PMI_RS01095 78.2 Proteus mirabilis HI4320 rnhA ribonuclease HI

Distribution of the homologs in the orthogroup group_1865

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1865

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N807 8.3e-96 276 84 0 151 3 rnhA Ribonuclease H Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q8GF77 1.59e-94 273 82 0 151 3 rnhA Ribonuclease H Photorhabdus luminescens
B4EUG3 1.9e-93 270 80 0 151 3 rnhA Ribonuclease H Proteus mirabilis (strain HI4320)
A4W6V4 5.08e-92 266 76 0 155 3 rnhA Ribonuclease H Enterobacter sp. (strain 638)
A8AKR0 6.13e-91 264 77 0 152 3 rnhA Ribonuclease H Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5Y1G2 1.07e-90 263 76 0 155 3 rnhA Ribonuclease H Klebsiella pneumoniae (strain 342)
P0A2B9 1.31e-90 263 77 0 152 3 rnhA Ribonuclease HI Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2C0 1.31e-90 263 77 0 152 3 rnhA Ribonuclease HI Salmonella typhi
B4TYH0 1.31e-90 263 77 0 152 3 rnhA Ribonuclease H Salmonella schwarzengrund (strain CVM19633)
B5BDW5 1.31e-90 263 77 0 152 3 rnhA Ribonuclease H Salmonella paratyphi A (strain AKU_12601)
A9MZ19 1.31e-90 263 77 0 152 3 rnhA Ribonuclease H Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PFD8 1.31e-90 263 77 0 152 3 rnhA Ribonuclease H Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SV39 1.31e-90 263 77 0 152 3 rnhA Ribonuclease H Salmonella newport (strain SL254)
B4TK85 1.31e-90 263 77 0 152 3 rnhA Ribonuclease H Salmonella heidelberg (strain SL476)
B5R5L3 1.31e-90 263 77 0 152 3 rnhA Ribonuclease H Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R449 1.31e-90 263 77 0 152 3 rnhA Ribonuclease H Salmonella enteritidis PT4 (strain P125109)
B5FJ58 1.31e-90 263 77 0 152 3 rnhA Ribonuclease H Salmonella dublin (strain CT_02021853)
Q57SZ6 1.31e-90 263 77 0 152 3 rnhA Ribonuclease H Salmonella choleraesuis (strain SC-B67)
A9MPF1 1.31e-90 263 77 0 152 3 rnhA Ribonuclease H Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F8X2 1.31e-90 263 77 0 152 3 rnhA Ribonuclease H Salmonella agona (strain SL483)
C0Q6N2 2.34e-90 262 77 0 152 3 rnhA Ribonuclease H Salmonella paratyphi C (strain RKS4594)
Q0TLC3 4.87e-90 261 77 0 152 3 rnhA Ribonuclease H Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7UJB0 4.87e-90 261 77 0 152 3 rnhA Ribonuclease H Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B1JR46 5.03e-90 261 76 0 153 3 rnhA Ribonuclease H Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q667M7 5.03e-90 261 76 0 153 3 rnhA Ribonuclease H Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TL54 5.03e-90 261 76 0 153 3 rnhA Ribonuclease H Yersinia pestis (strain Pestoides F)
Q1CFI6 5.03e-90 261 76 0 153 3 rnhA Ribonuclease H Yersinia pestis bv. Antiqua (strain Nepal516)
A9R0G0 5.03e-90 261 76 0 153 3 rnhA Ribonuclease H Yersinia pestis bv. Antiqua (strain Angola)
Q8ZH30 5.03e-90 261 76 0 153 3 rnhA Ribonuclease HI Yersinia pestis
B2KAC9 5.03e-90 261 76 0 153 3 rnhA Ribonuclease H Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CAJ5 5.03e-90 261 76 0 153 3 rnhA Ribonuclease H Yersinia pestis bv. Antiqua (strain Antiqua)
A7FFK7 5.03e-90 261 76 0 153 3 rnhA Ribonuclease H Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q6D1V7 1.07e-89 261 78 0 152 3 rnhA Ribonuclease H Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7MII6 1.46e-89 260 75 0 154 3 rnhA Ribonuclease H Vibrio vulnificus (strain YJ016)
Q8DBD5 1.46e-89 260 75 0 154 3 rnhA Ribonuclease HI Vibrio vulnificus (strain CMCP6)
C6DC65 1.9e-89 260 78 0 152 3 rnhA Ribonuclease H Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A1JKB1 4.32e-89 259 75 0 153 3 rnhA Ribonuclease H Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A7MI34 4.33e-89 259 75 0 153 3 rnhA Ribonuclease H Cronobacter sakazakii (strain ATCC BAA-894)
Q3Z5E9 7.56e-89 258 76 0 152 3 rnhA Ribonuclease H Shigella sonnei (strain Ss046)
P0A7Y7 7.56e-89 258 76 0 152 3 rnhA Ribonuclease HI Shigella flexneri
Q32JP9 7.56e-89 258 76 0 152 3 rnhA Ribonuclease H Shigella dysenteriae serotype 1 (strain Sd197)
Q325T2 7.56e-89 258 76 0 152 3 rnhA Ribonuclease H Shigella boydii serotype 4 (strain Sb227)
B2U352 7.56e-89 258 76 0 152 3 rnhA Ribonuclease H Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B7LW89 7.56e-89 258 76 0 152 3 rnhA Ribonuclease H Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B1LHM3 7.56e-89 258 76 0 152 3 rnhA Ribonuclease H Escherichia coli (strain SMS-3-5 / SECEC)
B6HZS7 7.56e-89 258 76 0 152 3 rnhA Ribonuclease H Escherichia coli (strain SE11)
B7N876 7.56e-89 258 76 0 152 3 rnhA Ribonuclease H Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7Y4 7.56e-89 258 76 0 152 1 rnhA Ribonuclease HI Escherichia coli (strain K12)
B1IPU4 7.56e-89 258 76 0 152 3 rnhA Ribonuclease H Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7Y5 7.56e-89 258 76 0 152 3 rnhA Ribonuclease HI Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
B1XD78 7.56e-89 258 76 0 152 3 rnhA Ribonuclease H Escherichia coli (strain K12 / DH10B)
C4ZRV1 7.56e-89 258 76 0 152 3 rnhA Ribonuclease H Escherichia coli (strain K12 / MC4100 / BW2952)
B7M213 7.56e-89 258 76 0 152 3 rnhA Ribonuclease H Escherichia coli O8 (strain IAI1)
B7MQ23 7.56e-89 258 76 0 152 3 rnhA Ribonuclease H Escherichia coli O81 (strain ED1a)
B7NKW4 7.56e-89 258 76 0 152 3 rnhA Ribonuclease H Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z0I8 7.56e-89 258 76 0 152 3 rnhA Ribonuclease H Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7Y6 7.56e-89 258 76 0 152 3 rnhA Ribonuclease HI Escherichia coli O157:H7
B7MBJ0 7.56e-89 258 76 0 152 3 rnhA Ribonuclease H Escherichia coli O45:K1 (strain S88 / ExPEC)
A7ZHV1 7.56e-89 258 76 0 152 3 rnhA Ribonuclease H Escherichia coli O139:H28 (strain E24377A / ETEC)
A6T512 2.03e-88 257 74 0 155 3 rnhA Ribonuclease H Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B7VIP1 2.44e-88 257 73 0 154 3 rnhA Ribonuclease H Vibrio atlanticus (strain LGP32)
A7ZWF6 3.43e-88 257 76 0 152 3 rnhA Ribonuclease H Escherichia coli O9:H4 (strain HS)
B7LHC0 3.43e-88 257 76 0 152 3 rnhA Ribonuclease H Escherichia coli (strain 55989 / EAEC)
Q87MG2 5.68e-88 256 74 0 154 3 rnhA Ribonuclease HI Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A8GA77 1.9e-87 255 74 0 155 3 rnhA Ribonuclease H Serratia proteamaculans (strain 568)
C5BEV5 1.43e-86 253 75 0 154 3 rnhA Ribonuclease H Edwardsiella ictaluri (strain 93-146)
A7MY21 2.64e-86 252 72 0 154 3 rnhA Ribonuclease H Vibrio campbellii (strain ATCC BAA-1116)
Q5E3G5 3.56e-86 252 76 0 148 3 rnhA Ribonuclease H Aliivibrio fischeri (strain ATCC 700601 / ES114)
C3LPN8 9.13e-85 248 71 0 153 3 rnhA Ribonuclease H Vibrio cholerae serotype O1 (strain M66-2)
Q9KPX8 9.13e-85 248 71 0 153 3 rnhA Ribonuclease HI Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F633 9.13e-85 248 71 0 153 3 rnhA Ribonuclease H Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B6EJV2 1.04e-84 248 75 0 148 3 rnhA Ribonuclease H Aliivibrio salmonicida (strain LFI1238)
B2VHJ5 2.61e-84 247 73 0 151 3 rnhA Ribonuclease H Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A0KXS6 4.94e-83 244 71 1 152 3 rnhA Ribonuclease H Shewanella sp. (strain ANA-3)
Q2NVF9 1.62e-82 243 73 0 152 3 rnhA Ribonuclease H Sodalis glossinidius (strain morsitans)
B1KHK0 3.12e-81 239 69 1 153 3 rnhA Ribonuclease H Shewanella woodyi (strain ATCC 51908 / MS32)
A1S6T0 7.4e-81 238 70 1 151 3 rnhA Ribonuclease H Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A3QET0 1.03e-80 238 75 1 147 3 rnhA Ribonuclease H Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q8EE30 1.08e-80 238 71 1 149 1 rnhA Ribonuclease HI Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A9L0F2 4.14e-80 236 70 1 150 3 rnhA Ribonuclease H Shewanella baltica (strain OS195)
A6WMW8 4.14e-80 236 70 1 150 3 rnhA Ribonuclease H Shewanella baltica (strain OS185)
A3D440 4.14e-80 236 70 1 150 3 rnhA Ribonuclease H Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E599 4.14e-80 236 70 1 150 3 rnhA Ribonuclease H Shewanella baltica (strain OS223)
Q0HI86 4.94e-80 236 71 1 149 3 rnhA Ribonuclease H Shewanella sp. (strain MR-4)
Q0HUI2 5.57e-80 236 71 1 149 3 rnhA Ribonuclease H Shewanella sp. (strain MR-7)
A1RK75 9.31e-79 233 69 1 150 3 rnhA Ribonuclease H Shewanella sp. (strain W3-18-1)
A4Y6C1 9.31e-79 233 69 1 150 3 rnhA Ribonuclease H Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A8FUS8 1.63e-78 232 70 1 150 3 rnhA Ribonuclease H Shewanella sediminis (strain HAW-EB3)
B0TRM1 2.34e-78 232 70 1 149 3 rnhA Ribonuclease H Shewanella halifaxensis (strain HAW-EB4)
A1SS86 5.73e-78 231 69 1 150 3 rnhA Ribonuclease H Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A0KIK4 4.91e-76 226 67 1 154 3 rnhA Ribonuclease H Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q081L4 2.09e-75 224 67 1 151 3 rnhA Ribonuclease H Shewanella frigidimarina (strain NCIMB 400)
Q12MM4 2.97e-75 224 65 1 152 3 rnhA Ribonuclease H Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
P57813 1.03e-74 223 64 0 153 3 rnhA Ribonuclease HI Pasteurella multocida (strain Pm70)
A4SPI4 1.93e-73 219 65 1 154 3 rnhA Ribonuclease H Aeromonas salmonicida (strain A449)
Q1LT02 3.05e-73 219 63 0 152 3 rnhA Ribonuclease H Baumannia cicadellinicola subsp. Homalodisca coagulata
C4LC60 1.97e-72 217 64 1 152 3 rnhA Ribonuclease H Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A5UFU3 2.5e-71 214 64 0 151 3 rnhA Ribonuclease H Haemophilus influenzae (strain PittGG)
Q4QP49 2.5e-71 214 64 0 151 3 rnhA Ribonuclease H Haemophilus influenzae (strain 86-028NP)
P43807 4.23e-71 213 64 0 151 3 rnhA Ribonuclease HI Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q65S82 5.75e-71 213 61 0 153 3 rnhA Ribonuclease H Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q3IIS1 1.05e-70 213 64 1 154 3 rnhA Ribonuclease H Pseudoalteromonas translucida (strain TAC 125)
Q493H7 1.11e-69 210 63 1 149 3 rnhA Ribonuclease H Blochmanniella pennsylvanica (strain BPEN)
A6VMP9 1.16e-69 210 63 0 152 3 rnhA Ribonuclease H Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q5QZL3 4.7e-69 208 59 1 151 3 rnhA Ribonuclease H Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q15TA7 4.44e-68 206 63 1 149 3 rnhA Ribonuclease H Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q3J7D4 9.88e-68 205 67 0 140 3 rnhA Ribonuclease H Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q89UU3 2.03e-66 202 69 0 134 3 rnhA Ribonuclease H Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A4Z216 5.43e-66 201 69 0 134 3 rnhA Ribonuclease H Bradyrhizobium sp. (strain ORS 278)
Q0VQ76 6.99e-66 200 70 0 133 3 rnhA Ribonuclease H Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q1QH30 2.66e-65 199 70 0 134 3 rnhA Ribonuclease H Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q7VQB6 2.79e-65 199 57 1 156 3 rnhA Ribonuclease H Blochmanniella floridana
A3MZE1 2.81e-65 199 60 0 147 3 rnhA Ribonuclease H Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q3SP51 3.03e-65 199 70 0 134 3 rnhA Ribonuclease H Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q7VM15 5.3e-65 198 58 0 150 3 rnhA Ribonuclease HI Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B0T025 3.64e-64 196 65 0 138 3 rnhA Ribonuclease H Caulobacter sp. (strain K31)
B6JJ39 3.98e-64 196 70 0 134 3 rnhA Ribonuclease H Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q2J0F8 4.47e-64 196 68 0 134 3 rnhA Ribonuclease H Rhodopseudomonas palustris (strain HaA2)
Q985W1 4.73e-64 196 58 1 165 3 rnhA Ribonuclease H Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A5EAL2 4.78e-64 196 67 0 134 3 rnhA Ribonuclease H Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A1WXD7 6.81e-64 195 68 0 133 3 rnhA Ribonuclease H Halorhodospira halophila (strain DSM 244 / SL1)
Q131J2 3.12e-63 193 67 0 134 3 rnhA Ribonuclease H Rhodopseudomonas palustris (strain BisB5)
B3Q6U1 3.28e-63 194 68 0 134 3 rnhA Ribonuclease H Rhodopseudomonas palustris (strain TIE-1)
Q6N1Y3 3.28e-63 194 68 0 134 3 rnhA Ribonuclease H Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q48KX6 3.52e-63 193 64 0 137 3 rnhA Ribonuclease H Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
P59434 1.18e-62 192 53 0 151 3 rnhA Ribonuclease H Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q88FF5 1.67e-62 191 63 0 137 3 rnhA Ribonuclease HI Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KN00 1.67e-62 191 63 0 137 3 rnhA Ribonuclease H Pseudomonas putida (strain GB-1)
A5W169 1.67e-62 191 63 0 137 3 rnhA Ribonuclease H Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q11KC5 1.69e-62 192 59 0 153 3 rnhA Ribonuclease H Chelativorans sp. (strain BNC1)
Q5H426 2.44e-62 191 65 0 137 3 rnhA Ribonuclease H Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P6Y2 2.44e-62 191 65 0 137 3 rnhA Ribonuclease H Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BWP3 3.17e-62 191 65 0 137 3 rnhA Ribonuclease H Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q7NYL8 3.25e-62 191 62 1 142 3 rnhA Ribonuclease H Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q87YT0 3.58e-62 191 64 0 137 3 rnhA Ribonuclease HI Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q8PNH8 5.03e-62 190 65 0 137 3 rnhA Ribonuclease H Xanthomonas axonopodis pv. citri (strain 306)
B1JBN1 5.8e-62 190 63 0 137 3 rnhA Ribonuclease H Pseudomonas putida (strain W619)
Q4ZVL1 6.4e-62 190 64 0 137 3 rnhA Ribonuclease H Pseudomonas syringae pv. syringae (strain B728a)
A6U6V5 9.79e-62 190 63 0 138 3 rnhA Ribonuclease H Sinorhizobium medicae (strain WSM419)
Q5NYP6 1.03e-61 190 62 0 143 3 rnhA Ribonuclease H Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A4XU11 1.17e-61 189 63 0 136 3 rnhA Ribonuclease H Pseudomonas mendocina (strain ymp)
A1B840 1.31e-61 189 64 1 137 3 rnhA Ribonuclease H Paracoccus denitrificans (strain Pd 1222)
Q8UHA7 1.51e-61 189 65 0 138 3 rnhA Ribonuclease H Agrobacterium fabrum (strain C58 / ATCC 33970)
Q92RG0 1.73e-61 189 63 0 138 3 rnhA Ribonuclease H Rhizobium meliloti (strain 1021)
Q2W9A9 2.15e-61 189 61 0 136 3 rnhA Ribonuclease H Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
B4R8T3 2.51e-61 189 65 0 138 3 rnhA Ribonuclease H Phenylobacterium zucineum (strain HLK1)
Q8PBX8 4.74e-61 188 64 0 137 3 rnhA Ribonuclease H Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4URM3 4.74e-61 188 64 0 137 3 rnhA Ribonuclease H Xanthomonas campestris pv. campestris (strain 8004)
P66674 5.39e-61 188 62 0 139 3 rnhA Ribonuclease HI Brucella suis biovar 1 (strain 1330)
B0CKG2 5.39e-61 188 62 0 139 3 rnhA Ribonuclease H Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VP47 5.39e-61 188 62 0 139 3 rnhA Ribonuclease H Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P66673 5.39e-61 188 62 0 139 3 rnhA Ribonuclease HI Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q57EP4 5.39e-61 188 62 0 139 3 rnhA Ribonuclease H Brucella abortus biovar 1 (strain 9-941)
Q2YMI3 5.39e-61 188 62 0 139 3 rnhA Ribonuclease H Brucella abortus (strain 2308)
Q1I7T4 6.24e-61 187 62 0 137 3 rnhA Ribonuclease H Pseudomonas entomophila (strain L48)
Q31H49 1.33e-60 187 62 0 139 3 rnhA Ribonuclease H Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
B8H4W7 2.89e-60 186 64 0 137 3 rnhA Ribonuclease H Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A341 2.89e-60 186 64 0 137 3 rnhA Ribonuclease HI Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q7WCJ8 4.04e-60 186 59 0 140 3 rnhA Ribonuclease H Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7VRX8 4.6e-60 186 59 0 140 3 rnhA Ribonuclease H Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q4KBI1 4.72e-60 185 63 0 137 3 rnhA Ribonuclease H Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q08885 5.71e-60 186 57 0 152 3 rnhA Ribonuclease H Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q1MKH6 6.63e-60 185 63 0 138 3 rnhA Ribonuclease H Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
A4VLR0 1.12e-59 184 63 1 138 3 rnhA Ribonuclease H Stutzerimonas stutzeri (strain A1501)
Q0A753 1.88e-59 184 64 0 130 3 rnhA Ribonuclease H Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q74BH0 2.44e-59 184 59 0 143 3 rnhA Ribonuclease H Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A7HQX4 3.46e-59 183 61 0 136 3 rnhA Ribonuclease H Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A1VFS4 4.15e-59 183 60 1 138 3 rnhA Ribonuclease H Nitratidesulfovibrio vulgaris (strain DP4)
Q72E89 4.15e-59 183 60 1 138 3 rnhA Ribonuclease H Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A1AT66 4.6e-59 183 58 0 139 3 rnhA Ribonuclease H Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q9JYE5 5.32e-59 182 58 1 143 3 rnhA Ribonuclease HI Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
B8DIU7 5.45e-59 183 58 2 150 3 rnhA Ribonuclease H Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
A6V705 6.19e-59 182 61 2 147 3 rnhA Ribonuclease H Pseudomonas aeruginosa (strain PA7)
Q9I2S9 8.14e-59 182 61 2 147 3 rnhA Ribonuclease HI Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02KV8 8.14e-59 182 61 2 147 3 rnhA Ribonuclease H Pseudomonas aeruginosa (strain UCBPP-PA14)
B7VB62 8.14e-59 182 61 2 147 3 rnhA Ribonuclease H Pseudomonas aeruginosa (strain LESB58)
Q2RPU6 8.56e-59 183 56 0 152 3 rnhA Ribonuclease H Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q3KE77 8.95e-59 182 62 0 135 3 rnhA Ribonuclease H Pseudomonas fluorescens (strain Pf0-1)
A0LGJ7 1.06e-58 182 63 0 136 3 rnhA Ribonuclease H Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q9JTD9 1.06e-58 182 58 1 143 3 rnhA Ribonuclease HI Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q2KBL2 1.15e-58 182 61 0 138 3 rnhA Ribonuclease H Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q47FN9 1.69e-58 181 60 0 140 3 rnhA Ribonuclease H Dechloromonas aromatica (strain RCB)
A1WFG9 1.82e-58 182 62 1 137 3 rnhA Ribonuclease H Verminephrobacter eiseniae (strain EF01-2)
Q60AW8 1.99e-58 181 56 0 144 3 rnhA Ribonuclease H Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q1GDG1 2.34e-58 181 63 1 138 3 rnhA Ribonuclease H Ruegeria sp. (strain TM1040)
Q1QW64 2.35e-58 182 59 0 139 3 rnhA Ribonuclease H Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q0AMI4 2.38e-58 181 62 1 135 3 rnhA Ribonuclease H Maricaulis maris (strain MCS10)
A1URX4 2.44e-58 181 58 0 143 3 rnhA Ribonuclease H Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q1LL89 4.8e-58 180 60 0 140 3 rnhA Ribonuclease H Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A6WWG8 7.23e-58 180 60 0 139 3 rnhA Ribonuclease H Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q3A827 7.48e-58 180 59 0 136 3 rnhA Ribonuclease H Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A9IQR5 8.14e-58 180 61 0 136 3 rnhA Ribonuclease H Bartonella tribocorum (strain CIP 105476 / IBS 506)
A5G5F6 1.6e-57 179 61 0 139 3 rnhA Ribonuclease H Geotalea uraniireducens (strain Rf4)
Q87C76 1.63e-57 179 62 0 137 3 rnhA Ribonuclease HI Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q5LNJ2 1.64e-57 179 63 1 138 3 rnhA Ribonuclease H Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
A1U0U9 1.82e-57 179 59 0 137 3 rnhA Ribonuclease H Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q9PBI6 2.19e-57 179 62 0 137 3 rnhA Ribonuclease HI Xylella fastidiosa (strain 9a5c)
A4WNV1 2.47e-57 179 59 2 144 3 rnhA Ribonuclease H Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q2KV56 2.6e-57 179 55 0 146 3 rnhA Ribonuclease H Bordetella avium (strain 197N)
A4J7B3 3.22e-57 179 58 1 143 3 rnhA Ribonuclease H Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
O69014 3.41e-57 178 59 0 144 3 rnhA Ribonuclease H Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A3PMR3 3.66e-57 178 59 1 137 3 rnhA Ribonuclease H Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q12B88 4.98e-57 178 62 1 140 3 rnhA Ribonuclease H Polaromonas sp. (strain JS666 / ATCC BAA-500)
A4G7G3 6.08e-57 177 57 0 145 3 rnhA Ribonuclease H Herminiimonas arsenicoxydans
A1KV38 6.86e-57 177 57 1 143 3 rnhA Ribonuclease H Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q5F7K9 6.94e-57 177 58 1 143 3 rnhA Ribonuclease H Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q2Y8K1 8.19e-57 177 57 0 143 3 rnhA Ribonuclease H Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q16AK0 9.38e-57 177 62 1 137 3 rnhA Ribonuclease H Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A6SXA4 9.64e-57 177 58 0 143 3 rnhA Ribonuclease H Janthinobacterium sp. (strain Marseille)
Q2G9E3 1.12e-56 177 60 0 137 3 rnhA Ribonuclease H Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q1H190 1.71e-56 176 56 0 141 3 rnhA Ribonuclease H Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q5WWW5 2.03e-56 176 58 0 142 3 rnhA Ribonuclease H Legionella pneumophila (strain Lens)
Q5ZVQ7 2.34e-56 176 58 0 142 3 rnhA Ribonuclease H Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IBM5 2.34e-56 176 58 0 142 3 rnhA Ribonuclease H Legionella pneumophila (strain Corby)
Q5X5I2 2.34e-56 176 58 0 142 3 rnhA Ribonuclease H Legionella pneumophila (strain Paris)
A1W6Q8 2.69e-56 176 60 1 142 3 rnhA Ribonuclease H Acidovorax sp. (strain JS42)
Q2ND39 2.7e-56 176 61 0 142 3 rnhA Ribonuclease H Erythrobacter litoralis (strain HTCC2594)
A8LLC1 2.72e-56 176 61 1 136 3 rnhA Ribonuclease H Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
A1VMW5 2.96e-56 176 60 1 140 3 rnhA Ribonuclease H Polaromonas naphthalenivorans (strain CJ2)
Q2SJ45 5.72e-56 175 60 0 133 3 rnhA Ribonuclease H Hahella chejuensis (strain KCTC 2396)
Q28V43 7.2e-56 175 59 1 138 3 rnhA Ribonuclease H Jannaschia sp. (strain CCS1)
A9KGQ0 1.79e-55 174 59 0 133 3 rnhA Ribonuclease H Coxiella burnetii (strain Dugway 5J108-111)
B6J1Y7 1.79e-55 174 59 0 133 3 rnhA Ribonuclease H Coxiella burnetii (strain CbuG_Q212)
Q83EK3 1.95e-55 174 59 0 133 3 rnhA Ribonuclease H Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NB52 1.95e-55 174 59 0 133 3 rnhA Ribonuclease H Coxiella burnetii (strain RSA 331 / Henzerling II)
B6J5V1 2.09e-55 174 59 0 133 3 rnhA Ribonuclease H Coxiella burnetii (strain CbuK_Q154)
Q8XZ91 3.86e-55 173 54 0 143 3 rnhA Ribonuclease H Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q0RJ31 7e-55 172 61 1 134 3 rnhA Ribonuclease H Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q0C3M1 1.18e-54 172 56 1 144 3 rnhA Ribonuclease H Hyphomonas neptunium (strain ATCC 15444)
A1TQI7 1.19e-54 172 58 1 142 3 rnhA Ribonuclease H Paracidovorax citrulli (strain AAC00-1)
Q3SIB2 1.85e-54 171 58 0 136 3 rnhA Ribonuclease H Thiobacillus denitrificans (strain ATCC 25259)
A5EXP9 1.91e-54 171 55 0 145 3 rnhA Ribonuclease H Dichelobacter nodosus (strain VCS1703A)
Q6G0C8 6.6e-54 170 57 0 136 3 rnhA Ribonuclease H Bartonella quintana (strain Toulouse)
Q01RW8 2.65e-53 168 54 0 143 3 rnhA Ribonuclease H Solibacter usitatus (strain Ellin6076)
Q21YF6 1.66e-52 166 55 1 142 3 rnhA Ribonuclease H Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q6G4C3 1.85e-52 166 55 0 136 3 rnhA Ribonuclease H Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A4SXM6 2.26e-52 166 55 0 138 3 rnhA Ribonuclease H Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q72IE1 2.76e-52 166 52 1 153 3 rnhA Ribonuclease H Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
P29253 5.32e-52 166 54 1 144 1 rnhA Ribonuclease H Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q0K8W6 7.13e-52 164 55 0 140 3 rnhA Ribonuclease H Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q0AE34 9.97e-52 165 54 1 147 3 rnhA Ribonuclease H Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q46Z81 1.73e-51 164 55 0 140 3 rnhA Ribonuclease H Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
B0TZ91 5.16e-51 162 53 0 138 3 rnhA Ribonuclease H Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q30X61 6.26e-51 162 56 1 139 3 rnhA Ribonuclease H Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A4FMU3 1.77e-50 161 56 2 137 3 rnhA Ribonuclease H Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q07705 2.46e-50 161 58 1 136 3 rnhA Ribonuclease H Mycolicibacterium smegmatis
A0R3Q8 2.46e-50 161 58 1 136 3 rnhA Ribonuclease H Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
B7JVG1 8.87e-50 160 52 2 151 3 rnhA Ribonuclease H Rippkaea orientalis (strain PCC 8801 / RF-1)
Q8D3D3 9.06e-50 159 48 0 152 3 rnhA Ribonuclease H Wigglesworthia glossinidia brevipalpis
Q5PBQ8 1.66e-49 159 54 1 140 3 rnhA Ribonuclease H Anaplasma marginale (strain St. Maries)
A8GPT6 1.8e-49 159 51 0 143 3 rnhA Ribonuclease H Rickettsia akari (strain Hartford)
Q0BQX7 2.7e-49 158 61 0 139 3 rnhA Ribonuclease H Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q2LWY9 2.95e-49 159 51 2 150 3 rnhA Ribonuclease H Syntrophus aciditrophicus (strain SB)
Q92GL5 3.99e-49 158 51 0 143 3 rnhA Ribonuclease HI Rickettsia conorii (strain ATCC VR-613 / Malish 7)
A8F2L0 4.04e-49 158 51 0 143 3 rnhA Ribonuclease H Rickettsia massiliae (strain Mtu5)
Q4UN27 5.19e-49 157 51 0 143 3 rnhA Ribonuclease H Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
A4IYE6 9.57e-49 157 51 0 138 3 rnhA Ribonuclease H Francisella tularensis subsp. tularensis (strain WY96-3418)
Q0BMB7 9.57e-49 157 51 0 138 3 rnhA Ribonuclease H Francisella tularensis subsp. holarctica (strain OSU18)
A0Q6W0 9.57e-49 157 51 0 138 3 rnhA Ribonuclease H Francisella tularensis subsp. novicida (strain U112)
B2SFV9 9.57e-49 157 51 0 138 3 rnhA Ribonuclease H Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A3X6 9.57e-49 157 51 0 138 3 rnhA Ribonuclease H Francisella tularensis subsp. holarctica (strain LVS)
A7NBM9 9.57e-49 157 51 0 138 3 rnhA Ribonuclease H Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14IN1 9.57e-49 157 51 0 138 3 rnhA Ribonuclease H Francisella tularensis subsp. tularensis (strain FSC 198)
A4T6Y5 7.64e-48 154 55 1 138 3 rnhA Ribonuclease H Mycolicibacterium gilvum (strain PYR-GCK)
A9KLJ9 9.8e-48 154 50 3 152 3 rnhA Ribonuclease H Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
P56120 1.38e-47 154 52 1 146 3 rnhA Ribonuclease HI Helicobacter pylori (strain ATCC 700392 / 26695)
Q1CTK9 2.34e-47 153 52 1 146 3 rnhA Ribonuclease H Helicobacter pylori (strain HPAG1)
Q39X47 4.01e-47 153 52 0 152 3 rnhA Ribonuclease H Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A8EXT7 4.65e-47 152 52 0 134 3 rnhA Ribonuclease H Rickettsia canadensis (strain McKiel)
Q82XV8 5.96e-47 152 51 1 145 3 rnhA Ribonuclease H Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q9ZLH3 6.11e-47 152 52 1 146 3 rnhA Ribonuclease HI Helicobacter pylori (strain J99 / ATCC 700824)
B5EMD8 6.84e-47 152 53 0 132 3 rnhA Ribonuclease H Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J4E2 6.84e-47 152 53 0 132 3 rnhA Ribonuclease H Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q1RJL7 7.27e-47 152 51 0 135 3 rnhA Ribonuclease H Rickettsia bellii (strain RML369-C)
Q68W20 1.75e-46 151 47 0 146 3 rnhA Ribonuclease H Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q9ZCK3 6.15e-46 150 47 0 146 3 rnhA Ribonuclease HI Rickettsia prowazekii (strain Madrid E)
Q5FG88 1.01e-45 149 52 0 137 3 rnhA Ribonuclease H Ehrlichia ruminantium (strain Gardel)
C0R2X2 1.32e-45 149 49 1 141 3 rnhA Ribonuclease H Wolbachia sp. subsp. Drosophila simulans (strain wRi)
Q17XJ7 1.45e-45 149 53 1 139 3 rnhA Ribonuclease H Helicobacter acinonychis (strain Sheeba)
A5CEP5 2.56e-45 149 52 0 133 3 rnhA Ribonuclease H Orientia tsutsugamushi (strain Boryong)
Q73I74 2.81e-45 148 49 1 141 3 rnhA Ribonuclease H Wolbachia pipientis wMel
Q67K93 3.76e-45 147 52 1 144 3 rnhA Ribonuclease H Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q5FUH9 7.6e-45 147 58 0 139 3 rnhA Ribonuclease H Gluconobacter oxydans (strain 621H)
Q3YR62 7.75e-45 147 51 0 137 3 rnhA Ribonuclease H Ehrlichia canis (strain Jake)
Q7UF86 9.19e-45 147 52 2 141 3 rnhA Ribonuclease H Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
A1AW38 1.04e-44 146 50 1 144 3 rnhA Ribonuclease H Ruthia magnifica subsp. Calyptogena magnifica
A5FZ26 2.66e-44 146 56 0 139 3 rnhA Ribonuclease H Acidiphilium cryptum (strain JF-5)
Q115G0 3.64e-44 145 45 3 153 3 rnhA Ribonuclease H Trichodesmium erythraeum (strain IMS101)
A8Z6F7 8.41e-44 144 50 1 137 3 rnhA Ribonuclease H Campylobacter concisus (strain 13826)
A3DD79 1.26e-43 144 49 1 144 3 rnhA Ribonuclease H Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q55801 1.51e-43 144 45 3 152 3 rnhA Ribonuclease HI Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B3QM41 1.88e-43 143 47 1 146 3 rnhA Ribonuclease H Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q2GHJ9 1.96e-43 143 49 0 137 3 rnhA Ribonuclease H Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
A4SFZ9 3.46e-43 142 49 1 141 3 rnhA Ribonuclease H Chlorobium phaeovibrioides (strain DSM 265 / 1930)
A1BE10 3.61e-42 140 47 1 144 3 rnhA Ribonuclease H Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
B0K1A7 4.03e-42 140 50 1 136 3 rnhA Ribonuclease H Thermoanaerobacter sp. (strain X514)
B0K9M0 4.03e-42 140 50 1 136 3 rnhA Ribonuclease H Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
B8HPS9 4.72e-42 140 48 3 139 3 rnhA Ribonuclease H Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Q2RKU0 6.07e-42 139 51 1 133 3 rnhA Ribonuclease H Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q8RA67 1.53e-41 139 51 1 134 3 rnhA Ribonuclease H Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q3B2H0 3.53e-41 137 47 1 143 3 rnhA Ribonuclease H Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
A7H185 8.57e-41 137 44 0 137 3 rnhA Ribonuclease H Campylobacter curvus (strain 525.92)
Q3APT0 1.1e-40 136 46 1 146 3 rnhA Ribonuclease H Chlorobium chlorochromatii (strain CaD3)
B2S2V0 1.44e-40 137 46 3 157 3 rnhA Ribonuclease H Treponema pallidum subsp. pallidum (strain SS14)
O83372 1.44e-40 137 46 3 157 3 rnhA Ribonuclease H Treponema pallidum (strain Nichols)
Q73K21 2.82e-40 135 45 2 155 3 rnhA Ribonuclease H Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
B3EH35 4.2e-40 135 45 1 146 3 rnhA Ribonuclease H Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
B3EMT1 4.63e-40 134 46 1 144 3 rnhA Ribonuclease H Chlorobium phaeobacteroides (strain BS1)
Q5HSF7 7.16e-40 134 48 3 147 3 rnhA Ribonuclease H Campylobacter jejuni (strain RM1221)
A1W1N8 7.16e-40 134 48 3 147 3 rnhA Ribonuclease H Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PM39 7.16e-40 134 48 3 147 3 rnhA Ribonuclease HI Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A8FNU8 7.16e-40 134 48 3 147 3 rnhA Ribonuclease H Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
A5CX29 1.36e-39 134 46 1 146 3 rnhA Ribonuclease H Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A7GAG3 3.81e-39 132 46 2 143 3 rnhA Ribonuclease H Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
A5HYU6 3.81e-39 132 46 2 143 3 rnhA Ribonuclease H Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FR34 3.81e-39 132 46 2 143 3 rnhA Ribonuclease H Clostridium botulinum (strain ATCC 19397 / Type A)
Q8DM24 3.81e-39 133 51 3 142 3 rnhA Ribonuclease H Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
B4S5K2 1.25e-38 131 45 1 144 3 rnhA Ribonuclease H Prosthecochloris aestuarii (strain DSM 271 / SK 413)
A4XKQ3 4.67e-38 129 46 1 136 3 rnhA Ribonuclease H Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
A9W185 2.46e-36 127 48 1 131 3 rnhA Ribonuclease H Methylorubrum extorquens (strain PA1)
A2C030 5.22e-35 122 46 3 135 3 rnhA Ribonuclease H Prochlorococcus marinus (strain NATL1A)
Q46HH3 5.63e-35 122 46 3 135 3 rnhA Ribonuclease H Prochlorococcus marinus (strain NATL2A)
Q0AV47 6.57e-35 121 44 2 142 3 rnhA Ribonuclease H Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q2GDA1 1.4e-34 121 44 2 139 3 rnhA Ribonuclease H Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
A6QCI9 2.88e-34 120 50 1 139 3 rnhA Ribonuclease H Sulfurovum sp. (strain NBC37-1)
Q7VDY9 1.89e-32 116 45 3 133 3 rnhA Ribonuclease H Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
A7HB50 5.73e-32 115 42 3 143 3 rnhA Ribonuclease H Anaeromyxobacter sp. (strain Fw109-5)
B4UMK8 1.83e-30 111 42 3 142 3 rnhA Ribonuclease H Anaeromyxobacter sp. (strain K)
B8J731 2.22e-30 111 42 3 142 3 rnhA Ribonuclease H Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
Q2IJL8 2.56e-30 111 43 3 142 3 rnhA Ribonuclease H Anaeromyxobacter dehalogenans (strain 2CP-C)
Q83GM3 6.99e-28 104 39 3 147 3 rnhA Ribonuclease H Tropheryma whipplei (strain Twist)
Q83HK9 6.99e-28 104 39 3 147 3 rnhA Ribonuclease H Tropheryma whipplei (strain TW08/27)
Q5BK46 9.73e-18 80 34 2 147 2 Rnaseh1 Ribonuclease H1 Rattus norvegicus
O70338 1.63e-17 80 34 2 147 2 Rnaseh1 Ribonuclease H1 Mus musculus
O60930 1.71e-16 77 34 2 147 1 RNASEH1 Ribonuclease H1 Homo sapiens
Q9UST8 1.2e-15 74 30 2 144 1 rnh1 Ribonuclease H Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9X7R6 5e-13 67 29 3 146 3 rnhA Ribonuclease HI Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q5UPY1 1.59e-11 63 28 2 123 3 RNH1 Probable ribonuclease H Acanthamoeba polyphaga mimivirus
Q07762 1.12e-08 56 29 6 158 3 RNH1 Ribonuclease H Crithidia fasciculata
Q04740 4.04e-07 51 28 6 160 1 RNH1 Ribonuclease H Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P54162 5.54e-06 46 27 5 138 1 rnhA 14.7 kDa ribonuclease H-like protein Bacillus subtilis (strain 168)
P27980 9.15e-05 45 31 4 130 3 gag-pol Gag-Pol polyprotein Simian immunodeficiency virus agm.vervet (isolate AGM3)
Q79666 0.000696 42 32 3 96 3 gag-pol Gag-Pol polyprotein Human immunodeficiency virus type 1 group O (isolate MVP5180)
Q87040 0.000782 42 26 5 146 3 pol Pro-Pol polyprotein Simian foamy virus (isolate chimpanzee)
Q77373 0.000881 42 32 3 96 3 gag-pol Gag-Pol polyprotein Human immunodeficiency virus type 1 group O (isolate ANT70)

  • Number of RefSeq hits:

General

Source Morganella morganii S1
Locus tag FBDBKF_13945
Feature type CDS
Gene rnhA
Product ribonuclease HI
Location 82820 - 83290 (strand: 1)
Length 471 (nucleotides) / 156 (amino acids)

Contig

Accession contig_17
Length 103646 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1865
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00075 RNase H

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0328 Replication, recombination and repair (L) L Ribonuclease HI

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03469 ribonuclease HI [EC:3.1.26.4] DNA replication -

Protein Sequence

MSDKVEIFTDGSCLGNPGPGGYGALLRYKGHEKALSEGFFLTTNNRMELLAAIVALETLKRPCNIVLTTDSQYVRQGITQWIHNWKRRGWRKADKSPVVNVDLWQRLDAAITRHQIDWQWVKGHAGHPENERCDELARAAAESPSQDDTGYQPATE

Flanking regions ( +/- flanking 50bp)

GTGTCAGACTCAGGTAATTGCCAATCAATCAGAGGAAGAGTCTACCAGAGATGAGTGACAAGGTAGAAATTTTCACCGACGGCTCCTGCCTCGGAAATCCGGGCCCCGGCGGCTACGGCGCGCTGCTGCGTTATAAAGGCCATGAGAAAGCACTCAGTGAGGGCTTTTTTCTTACCACCAATAACCGGATGGAGCTGCTGGCCGCTATTGTGGCGCTGGAAACCCTGAAACGTCCGTGTAATATCGTGCTGACCACCGACAGCCAGTATGTCCGTCAGGGCATCACACAGTGGATCCATAACTGGAAGCGGCGCGGCTGGCGCAAAGCGGATAAATCCCCGGTGGTGAATGTCGATTTGTGGCAGCGCCTGGATGCCGCCATCACCCGCCATCAGATTGACTGGCAGTGGGTGAAAGGTCATGCAGGGCACCCGGAAAACGAGCGCTGTGATGAACTCGCCCGGGCAGCGGCAGAATCTCCGTCACAGGACGATACCGGTTATCAGCCGGCAACGGAGTAATCCTCAGCGCCGTTTCAGACAGCGCGGCGGCGTCTGCTGGCGTGTCGCGC