Homologs in group_1868

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13960 FBDBKF_13960 54.0 Morganella morganii S1 mltD murein transglycosylase D
EHELCC_11630 EHELCC_11630 54.0 Morganella morganii S2 mltD murein transglycosylase D
NLDBIP_11975 NLDBIP_11975 54.0 Morganella morganii S4 mltD murein transglycosylase D
LHKJJB_11835 LHKJJB_11835 54.0 Morganella morganii S3 mltD murein transglycosylase D
HKOGLL_10445 HKOGLL_10445 54.0 Morganella morganii S5 mltD murein transglycosylase D
F4V73_RS12815 F4V73_RS12815 54.3 Morganella psychrotolerans mltD murein transglycosylase D

Distribution of the homologs in the orthogroup group_1868

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1868

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AEZ7 1.47e-122 367 41 8 453 1 mltD Membrane-bound lytic murein transglycosylase D Escherichia coli (strain K12)
P0AEZ8 1.47e-122 367 41 8 453 3 mltD Membrane-bound lytic murein transglycosylase D Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P32820 4.01e-36 135 52 0 119 3 tbtA Putative tributyltin chloride resistance protein Alteromonas sp. (strain M-1)
P54421 3.07e-09 62 43 2 93 1 lytE Probable peptidoglycan endopeptidase LytE Bacillus subtilis (strain 168)
O31852 1.14e-08 60 41 3 92 1 cwlS D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS Bacillus subtilis (strain 168)
O31852 8.75e-06 51 33 4 106 1 cwlS D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS Bacillus subtilis (strain 168)
O64046 5.86e-08 59 36 3 122 3 yomI Probable tape measure protein Bacillus phage SPbeta
O31976 6.12e-08 58 36 3 122 3 yomI SPbeta prophage-derived uncharacterized transglycosylase YomI Bacillus subtilis (strain 168)
Q4L3C1 7.4e-08 57 34 4 126 3 sle1 N-acetylmuramoyl-L-alanine amidase sle1 Staphylococcus haemolyticus (strain JCSC1435)
O07532 2.17e-07 56 35 2 96 1 lytF Peptidoglycan endopeptidase LytF Bacillus subtilis (strain 168)
O07532 7.42e-05 48 31 2 91 1 lytF Peptidoglycan endopeptidase LytF Bacillus subtilis (strain 168)
O07532 9.81e-05 48 31 3 109 1 lytF Peptidoglycan endopeptidase LytF Bacillus subtilis (strain 168)
A0A0H3C9Q9 5.55e-07 55 32 2 92 3 dipM Cell division protein DipM Caulobacter vibrioides (strain NA1000 / CB15N)
P37710 6.14e-07 55 34 4 96 1 EF_0799 Autolysin Enterococcus faecalis (strain ATCC 700802 / V583)
P37710 0.000179 47 30 2 97 1 EF_0799 Autolysin Enterococcus faecalis (strain ATCC 700802 / V583)
P37710 0.000254 47 32 2 97 1 EF_0799 Autolysin Enterococcus faecalis (strain ATCC 700802 / V583)
P0DPJ9 1.13e-06 54 36 2 92 2 sleL Cortical fragment-lytic enzyme Bacillus anthracis
Q9K3E4 1.24e-06 54 36 2 92 1 sleL Cortical fragment-lytic enzyme Bacillus cereus
A2RHZ5 1.52e-06 53 33 5 107 3 acmA Probable N-acetylmuramidase Lactococcus lactis subsp. cremoris (strain MG1363)
P0C2T5 2.2e-06 53 33 5 107 3 acmA Probable N-acetylmuramidase Lactococcus lactis subsp. cremoris
P39046 2.29e-06 53 29 4 122 1 EHR_05900 Muramidase-2 Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R)
P39046 0.000277 47 26 5 121 1 EHR_05900 Muramidase-2 Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R)
F9XMT4 2.47e-06 52 31 4 113 2 Mg3LysM Secreted LysM effector Mg3LysM Zymoseptoria tritici (strain CBS 115943 / IPO323)
F9XMT4 5.29e-05 48 30 4 109 2 Mg3LysM Secreted LysM effector Mg3LysM Zymoseptoria tritici (strain CBS 115943 / IPO323)
A0A1X7S690 2.62e-06 52 31 4 113 2 Mg3LysM Secreted LysM effector Mg3LysM Zymoseptoria tritici (strain ST99CH_3D7)
A0A1X7S690 5.1e-05 48 30 4 109 2 Mg3LysM Secreted LysM effector Mg3LysM Zymoseptoria tritici (strain ST99CH_3D7)
Q4WRR0 3.22e-06 52 25 6 174 3 ldpB Secreted LysM effector ldpB Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293)
O31608 4.87e-06 50 32 3 113 1 cwlQ Bifunctional muramidase/lytic transglycosylase CwlQ Bacillus subtilis (strain 168)
Q46798 5.06e-06 51 45 1 61 3 ygeR Uncharacterized lipoprotein YgeR Escherichia coli (strain K12)
P11187 6.19e-06 51 30 2 108 1 15 Endolysin Bacillus phage phi29
Q8CMN2 1.01e-05 50 30 5 126 3 sle1 N-acetylmuramoyl-L-alanine amidase sle1 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q8CMN2 1.35e-05 50 27 2 105 3 sle1 N-acetylmuramoyl-L-alanine amidase sle1 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRU2 1.01e-05 50 30 5 126 3 sle1 N-acetylmuramoyl-L-alanine amidase sle1 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q5HRU2 1.35e-05 50 27 2 105 3 sle1 N-acetylmuramoyl-L-alanine amidase sle1 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q49UX4 1.69e-05 50 33 3 104 3 sle1 N-acetylmuramoyl-L-alanine amidase sle1 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
P07540 1.88e-05 49 30 2 108 3 15 Endolysin Bacillus phage PZA
Q8DVU8 2.88e-05 48 38 0 52 3 SMU_367 Putative hydrolase SMU_367 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q2G0D4 2.97e-05 48 29 2 113 1 SAOUHSC_00671 Probable autolysin SsaALP Staphylococcus aureus (strain NCTC 8325 / PS 47)
P37531 0.000158 47 31 1 92 1 sleL Cortical fragment-lytic enzyme Bacillus subtilis (strain 168)
A0L862 0.000259 47 25 5 177 3 mltF Membrane-bound lytic murein transglycosylase F Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
Q2YVT4 0.000273 46 32 4 110 3 sle1 N-acetylmuramoyl-L-alanine amidase sle1 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q7A1T4 0.000298 46 32 4 110 3 sle1 N-acetylmuramoyl-L-alanine amidase sle1 Staphylococcus aureus (strain MW2)
P0C1U7 0.000298 46 32 4 110 3 sle1 N-acetylmuramoyl-L-alanine amidase sle1 Staphylococcus aureus
Q6GC24 0.000298 46 32 4 110 3 sle1 N-acetylmuramoyl-L-alanine amidase sle1 Staphylococcus aureus (strain MSSA476)
Q7A7E0 0.000298 46 32 4 110 1 sle1 N-acetylmuramoyl-L-alanine amidase sle1 Staphylococcus aureus (strain N315)
Q5HIL2 0.000298 46 32 4 110 3 sle1 N-acetylmuramoyl-L-alanine amidase sle1 Staphylococcus aureus (strain COL)
Q2G0U9 0.000298 46 32 4 110 1 sle1 N-acetylmuramoyl-L-alanine amidase sle1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJH7 0.000298 46 32 4 110 3 sle1 N-acetylmuramoyl-L-alanine amidase sle1 Staphylococcus aureus (strain USA300)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS01080
Feature type CDS
Gene mltD
Product murein transglycosylase D
Location 267762 - 269096 (strand: -1)
Length 1335 (nucleotides) / 444 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1868
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01464 Transglycosylase SLT domain
PF01476 LysM domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0741 Cell wall/membrane/envelope biogenesis (M) M Soluble lytic murein transglycosylase or regulatory protein s ( may contain LysM/invasin domain)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K08307 peptidoglycan lytic transglycosylase D [EC:4.2.2.29] - -

Protein Sequence

MKTKVILFSILLLAGCQQSKSIKPDLSAITPTSLGTSTSYQPQYDIKTNLWGYVVSELKMDIPDNERISQQETYFLNNPKHIQTVALRAEPYMYWIIEEIEKRDLPMELALVPVVESAFNPHVTSSAKAAGLWQFVPVTANYYGLAQNQWYDGRRDVVASTNAALDLLERLYIMFDSDWPLALAAYNAGEGRVMQAIKANESKNLPTDYWSLSLPKETMNYVPKILALSKVIRDNEADITFPKSNYRDKSLAAIDIGEQITLSKVAELSQLPITTVKDYNPGYKRGITAPNGPHVILLPRNKLAQFQNAFADEAILKTIRLAVAKANQSIKQEGIYKVRSGDSFYAIARRYNMSVKELQRLNGLSAKSTLLVGQTLKIHNAGSVNNRPTGKPTGASPSYYKVRQGDSYYSIARRHNINLKQLMSWNADIKMLKPGTQLTLYLKK

Flanking regions ( +/- flanking 50bp)

GAACACTAGTATTATTTAGGGCAAAAAACACACAGGACTAATTTTCGAACATGAAGACAAAAGTGATTTTGTTCTCTATATTGCTATTGGCGGGTTGCCAGCAATCTAAGAGCATAAAACCCGATTTGTCTGCGATAACACCCACATCTTTAGGGACTTCAACTTCTTACCAACCACAATATGATATAAAAACCAATTTGTGGGGTTATGTAGTAAGTGAATTAAAAATGGATATCCCTGACAATGAAAGGATTTCGCAGCAAGAAACTTATTTTTTAAATAATCCAAAACATATACAAACCGTTGCATTACGTGCAGAGCCTTATATGTATTGGATTATTGAGGAAATAGAAAAACGTGATCTACCGATGGAGCTTGCACTGGTTCCGGTGGTGGAAAGTGCGTTTAATCCTCATGTCACCTCTTCAGCTAAAGCGGCTGGCTTATGGCAATTTGTCCCTGTCACAGCTAATTATTATGGTCTAGCACAAAATCAATGGTATGACGGTCGCCGTGATGTTGTCGCTTCTACTAATGCAGCCTTAGATTTGCTTGAACGCCTTTACATTATGTTTGATAGCGACTGGCCTTTAGCATTAGCCGCTTACAATGCGGGCGAAGGTCGTGTTATGCAAGCGATAAAAGCTAATGAAAGCAAAAATCTACCTACCGATTACTGGTCACTTTCATTACCCAAAGAGACCATGAATTATGTGCCTAAAATTCTCGCCTTAAGTAAAGTTATCCGTGACAATGAAGCCGATATCACTTTCCCGAAAAGTAACTATCGCGATAAATCATTAGCCGCAATTGATATTGGCGAACAGATAACATTAAGCAAAGTCGCTGAACTTAGCCAATTACCTATTACAACCGTAAAAGACTATAACCCAGGCTATAAGCGCGGGATCACCGCACCAAATGGCCCTCATGTTATTTTGCTTCCTCGTAATAAACTTGCGCAGTTCCAAAATGCGTTTGCTGACGAAGCGATTTTAAAGACCATCCGTTTAGCGGTCGCTAAAGCCAATCAGTCGATTAAACAAGAAGGTATTTATAAAGTCCGCTCCGGTGATTCTTTTTATGCCATTGCTCGACGTTATAATATGAGCGTAAAAGAGCTACAACGACTCAATGGATTAAGTGCAAAGAGTACCCTATTAGTTGGGCAAACATTAAAAATTCATAATGCAGGTAGTGTGAACAATCGTCCGACAGGCAAACCAACCGGCGCTTCACCAAGTTACTATAAAGTTCGTCAAGGTGACTCTTATTACAGTATTGCTCGTCGTCACAATATTAATCTTAAGCAATTAATGAGCTGGAATGCTGATATCAAGATGTTAAAACCGGGAACGCAATTAACGCTTTACTTAAAAAAATAGTTTTTAGCGCCTTGATAAACAGTTAACGCCATCTAACTATCGAGCGGATA