Homologs in group_299

Help

7 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07915 FBDBKF_07915 85.5 Morganella morganii S1 fbpC ferric ABC transporter ATP-binding protein
EHELCC_13745 EHELCC_13745 85.5 Morganella morganii S2 fbpC ferric ABC transporter ATP-binding protein
NLDBIP_14190 NLDBIP_14190 85.5 Morganella morganii S4 fbpC ferric ABC transporter ATP-binding protein
LHKJJB_08660 LHKJJB_08660 85.5 Morganella morganii S3 fbpC ferric ABC transporter ATP-binding protein
HKOGLL_08210 HKOGLL_08210 85.5 Morganella morganii S5 fbpC ferric ABC transporter ATP-binding protein
F4V73_RS13070 F4V73_RS13070 85.5 Morganella psychrotolerans fbpC ferric ABC transporter ATP-binding protein
PMI_RS05675 PMI_RS05675 31.9 Proteus mirabilis HI4320 fetA iron ABC transporter ATP-binding protein FetA

Distribution of the homologs in the orthogroup group_299

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_299

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N8B9 0.0 625 85 0 345 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6D734 0.0 608 84 0 344 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P37009 0.0 583 80 1 345 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Escherichia coli (strain K12)
Q7AH43 0.0 579 79 1 345 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Escherichia coli O157:H7
Q6LKD4 1.35e-168 476 67 1 347 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Photobacterium profundum (strain SS9)
Q9KLQ5 8.67e-163 461 65 1 347 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9CM80 1.01e-154 441 62 2 348 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pasteurella multocida (strain Pm70)
Q65S66 3.47e-154 439 62 2 344 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q0I2Z4 2.15e-153 437 64 3 345 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Histophilus somni (strain 129Pt)
P44531 1.69e-144 414 68 1 304 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q57293 7.35e-142 408 59 2 344 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Actinobacillus pleuropneumoniae
Q2K8C8 3.62e-103 310 49 3 325 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q8U6M1 3.74e-103 310 48 2 330 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Agrobacterium fabrum (strain C58 / ATCC 33970)
Q578K3 8.21e-102 306 48 3 319 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella abortus biovar 1 (strain 9-941)
Q2YKX3 8.21e-102 306 48 3 319 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella abortus (strain 2308)
Q8FVV5 8.96e-102 306 48 3 319 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella suis biovar 1 (strain 1330)
Q8YCG3 3.89e-101 305 48 3 319 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q92WJ0 7.55e-101 304 50 3 320 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Rhizobium meliloti (strain 1021)
Q8XIZ5 4.04e-93 284 43 1 320 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain 13 / Type A)
Q0TNZ3 4.04e-93 284 43 1 320 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q03PF2 2.69e-92 283 41 4 348 3 potA Spermidine/putrescine import ATP-binding protein PotA Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
Q0SRL2 1.17e-90 278 41 1 320 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium perfringens (strain SM101 / Type A)
A0LUE6 3e-89 275 41 7 357 3 potA Spermidine/putrescine import ATP-binding protein PotA Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
P74548 2.89e-88 272 41 4 333 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q97KS6 4.38e-88 271 39 4 347 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q9K876 1.88e-87 270 41 3 329 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q830W6 1.92e-87 270 40 3 344 3 potA Spermidine/putrescine import ATP-binding protein PotA Enterococcus faecalis (strain ATCC 700802 / V583)
Q0I3Y9 2.84e-87 270 44 5 321 3 potA Spermidine/putrescine import ATP-binding protein PotA Histophilus somni (strain 129Pt)
P45171 3.69e-87 270 45 4 319 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O85818 4.2e-87 270 44 4 318 3 potA Spermidine/putrescine import ATP-binding protein PotA Aggregatibacter actinomycetemcomitans
A1TXH7 4.33e-87 270 44 4 322 3 potA Spermidine/putrescine import ATP-binding protein PotA Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A0PY57 4.74e-87 268 39 3 345 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridium novyi (strain NT)
Q4QK57 5.1e-87 269 44 4 327 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus influenzae (strain 86-028NP)
Q88ZJ6 1.22e-86 268 40 4 343 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
Q74K65 1.57e-86 268 40 3 326 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q6F0V4 2.85e-86 267 39 3 326 3 potA Spermidine/putrescine import ATP-binding protein PotA Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1)
O31339 3.69e-86 266 39 4 351 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 10987 / NRS 248)
Q1AS06 4.12e-86 267 45 2 305 3 potA Spermidine/putrescine import ATP-binding protein PotA Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q65UE1 1.16e-85 266 43 4 327 3 potA Spermidine/putrescine import ATP-binding protein PotA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q38VW6 2.59e-85 265 40 1 307 3 potA Spermidine/putrescine import ATP-binding protein PotA Latilactobacillus sakei subsp. sakei (strain 23K)
P55604 2.6e-85 265 40 5 334 3 NGR_a02170 Uncharacterized ABC transporter ATP-binding protein y4oS Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q7NIW1 3.4e-85 264 41 5 341 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q18AM3 5.51e-85 263 38 3 343 3 potA Spermidine/putrescine import ATP-binding protein PotA Clostridioides difficile (strain 630)
Q30V33 6.22e-85 264 51 0 247 3 potA Spermidine/putrescine import ATP-binding protein PotA Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q160M2 7.4e-85 263 51 0 241 3 potA Spermidine/putrescine import ATP-binding protein PotA Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q8Z245 9.73e-85 263 41 6 339 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Salmonella typhi
Q72FW5 1.05e-84 263 49 0 251 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A3DDF6 2.26e-84 262 38 3 347 3 potA Spermidine/putrescine import ATP-binding protein PotA Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q8DUF7 2.29e-84 263 43 2 304 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q7VNG4 3.76e-84 262 42 4 322 3 potA Spermidine/putrescine import ATP-binding protein PotA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q57IS3 4.06e-84 261 41 6 339 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Salmonella choleraesuis (strain SC-B67)
Q1GIE5 4.49e-84 262 42 3 331 3 potA Spermidine/putrescine import ATP-binding protein PotA Ruegeria sp. (strain TM1040)
Q14Q07 4.94e-84 261 40 2 320 3 potA Spermidine/putrescine import ATP-binding protein PotA Spiroplasma citri
Q042G7 6.66e-84 261 40 3 326 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q98HF7 7.01e-84 261 52 1 245 3 potA Spermidine/putrescine import ATP-binding protein PotA Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q6F9A8 7.66e-84 261 44 1 284 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q8ZLF4 8.76e-84 261 41 6 339 1 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q5FL41 9.58e-84 261 39 3 323 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q03AH0 1.04e-83 261 38 4 343 3 potA Spermidine/putrescine import ATP-binding protein PotA Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q5ZWE4 1.4e-83 260 48 0 238 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q8E8K8 1.5e-83 260 40 4 340 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q8Z0H0 2.56e-83 259 41 3 303 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q81GU1 2.64e-83 259 39 4 351 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q5PJL1 4.4e-83 259 41 6 339 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q2SJY7 5.07e-83 259 46 3 291 3 potA Spermidine/putrescine import ATP-binding protein PotA Hahella chejuensis (strain KCTC 2396)
Q47T99 5.09e-83 259 41 5 344 3 potA Spermidine/putrescine import ATP-binding protein PotA Thermobifida fusca (strain YX)
Q5YZY9 5.72e-83 258 40 5 340 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nocardia farcinica (strain IFM 10152)
Q5WXF0 5.91e-83 259 48 0 238 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Lens)
Q9CP06 6.63e-83 259 43 6 337 3 potA Spermidine/putrescine import ATP-binding protein PotA Pasteurella multocida (strain Pm70)
Q8ELR4 9.48e-83 258 38 4 342 3 potA Spermidine/putrescine import ATP-binding protein PotA Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q88CL2 1.26e-82 256 40 4 325 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q04G50 1.31e-82 258 43 1 304 3 potA Spermidine/putrescine import ATP-binding protein PotA Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q5X627 2.14e-82 257 48 0 238 3 potA Spermidine/putrescine import ATP-binding protein PotA Legionella pneumophila (strain Paris)
Q5M397 4.61e-82 257 39 5 343 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LYN4 4.82e-82 257 39 5 343 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain CNRZ 1066)
Q03JH1 5.14e-82 257 39 5 343 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q7NWX3 5.23e-82 256 52 1 242 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q82TL6 5.9e-82 256 49 0 240 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q5LT05 6.08e-82 256 44 1 296 3 potA Spermidine/putrescine import ATP-binding protein PotA Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q5L222 6.34e-82 256 36 3 346 3 potA Spermidine/putrescine import ATP-binding protein PotA Geobacillus kaustophilus (strain HTA426)
A3CMQ7 7.4e-82 256 42 2 304 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus sanguinis (strain SK36)
Q3MAR5 1.39e-81 256 41 5 335 3 potA Spermidine/putrescine import ATP-binding protein PotA Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q7WGW1 1.42e-81 255 39 2 324 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q8A883 1.42e-81 258 40 3 316 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q8DIA0 1.61e-81 254 43 4 300 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
P54933 1.77e-81 254 40 4 340 3 smoK ATP-binding transport protein SmoK Cereibacter sphaeroides
Q609Q1 1.83e-81 254 44 1 283 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q1B8V9 1.9e-81 256 40 9 359 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycobacterium sp. (strain MCS)
A1UG51 1.9e-81 256 40 9 359 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycobacterium sp. (strain KMS)
A1JIE0 1.93e-81 254 40 8 354 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q110U3 2.18e-81 255 40 3 341 3 potA Spermidine/putrescine import ATP-binding protein PotA Trichodesmium erythraeum (strain IMS101)
Q1GID1 2.38e-81 254 42 4 316 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Ruegeria sp. (strain TM1040)
Q8DPC2 2.54e-81 255 42 3 304 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97Q42 2.54e-81 255 42 3 304 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04JW0 2.54e-81 255 42 3 304 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q5LBT4 2.63e-81 258 40 4 316 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q49WM4 3.23e-81 254 40 1 301 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q6D201 3.79e-81 253 39 4 323 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8YM92 4.36e-81 254 41 5 335 3 potA Spermidine/putrescine import ATP-binding protein PotA Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q02Z10 4.36e-81 256 42 2 304 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactococcus lactis subsp. cremoris (strain SK11)
Q64SQ6 4.6e-81 257 40 4 316 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacteroides fragilis (strain YCH46)
Q7VZE5 5.62e-81 253 38 2 324 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q9CGD4 5.85e-81 256 38 4 344 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactococcus lactis subsp. lactis (strain IL1403)
Q0SML1 5.9e-81 253 37 2 316 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella afzelii (strain PKo)
O51587 6.43e-81 253 37 2 316 3 potA Spermidine/putrescine import ATP-binding protein PotA Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q7W9U5 6.54e-81 253 38 2 324 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q9I6L0 9.83e-81 252 48 2 241 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q24XJ2 9.9e-81 253 38 4 342 3 potA Spermidine/putrescine import ATP-binding protein PotA Desulfitobacterium hafniense (strain Y51)
Q660M8 1.5e-80 252 37 2 316 3 potA Spermidine/putrescine import ATP-binding protein PotA Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q7CN92 1.7e-80 253 39 5 343 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q99ZS8 1.7e-80 253 39 5 343 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M1
Q88AS5 2.13e-80 251 40 5 325 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q6HLQ9 2.2e-80 251 44 2 269 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q4L5B3 2.44e-80 252 40 1 300 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus haemolyticus (strain JCSC1435)
Q0AGF4 2.85e-80 252 49 0 240 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q8DZJ0 3.02e-80 252 38 5 342 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E554 3.02e-80 252 38 5 342 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype III (strain NEM316)
Q3K0Y6 3.02e-80 252 38 5 342 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q5XCA4 3.36e-80 252 39 5 343 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q8RGC8 3.49e-80 252 43 2 282 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q82WT5 4.08e-80 251 37 4 350 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q8UBB7 4.6e-80 251 45 3 288 3 ugpC2 sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
P0CZ35 4.8e-80 252 39 5 343 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48TP4 4.8e-80 252 39 5 343 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M28 (strain MGAS6180)
P0CZ34 4.8e-80 252 39 5 343 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q1J6Q6 7.31e-80 251 39 5 343 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JGY7 7.31e-80 251 39 5 343 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JLT7 7.31e-80 251 39 5 343 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JBV6 7.31e-80 251 39 5 343 3 potA Spermidine/putrescine import ATP-binding protein PotA Streptococcus pyogenes serotype M12 (strain MGAS2096)
P14788 7.8e-80 250 43 2 276 2 cysA Sulfate/thiosulfate import ATP-binding protein CysA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q8UA73 8.93e-80 250 51 1 237 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
A1TAI4 9.28e-80 251 40 8 360 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q63E84 1.28e-79 249 45 2 266 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ZK / E33L)
Q73BM0 1.28e-79 249 45 2 266 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ATCC 10987 / NRS 248)
A0RBB0 1.28e-79 249 45 2 266 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus thuringiensis (strain Al Hakam)
Q8UH62 1.71e-79 249 44 3 290 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q81TH8 2.16e-79 248 45 2 266 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus anthracis
Q02R79 2.22e-79 249 46 3 289 3 potA Spermidine/putrescine import ATP-binding protein PotA Pseudomonas aeruginosa (strain UCBPP-PA14)
Q9KS33 2.27e-79 250 49 0 240 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q1MQ44 2.38e-79 249 44 3 285 3 potA Spermidine/putrescine import ATP-binding protein PotA Lawsonia intracellularis (strain PHE/MN1-00)
P10907 2.44e-79 249 40 5 338 1 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Escherichia coli (strain K12)
Q9HY19 2.44e-79 249 46 3 289 3 potA2 Spermidine/putrescine import ATP-binding protein PotA 2 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A1B9Q7 3.01e-79 249 44 3 299 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Paracoccus denitrificans (strain Pd 1222)
Q31VH5 3.02e-79 249 40 5 338 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Shigella boydii serotype 4 (strain Sb227)
Q1WVI7 3.69e-79 249 39 3 316 3 potA Spermidine/putrescine import ATP-binding protein PotA Ligilactobacillus salivarius (strain UCC118)
Q1R5H8 4.14e-79 248 40 5 338 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Escherichia coli (strain UTI89 / UPEC)
A1AGY1 4.14e-79 248 40 5 338 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Escherichia coli O1:K1 / APEC
Q21CA3 4.68e-79 249 45 2 285 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Rhodopseudomonas palustris (strain BisB18)
Q7NX01 4.74e-79 248 48 1 239 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q8FVT0 5.81e-79 248 43 1 283 3 BRA0745 Putative ATP-binding protein BRA0745/BS1330_II0738 Brucella suis biovar 1 (strain 1330)
Q3YW77 5.85e-79 248 40 5 338 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Shigella sonnei (strain Ss046)
Q2K4V4 5.89e-79 249 43 2 283 3 ugpC2 sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q6NBT1 5.9e-79 248 37 4 344 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q98G42 7.3e-79 248 39 4 341 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q9JUX4 7.4e-79 248 40 2 294 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q03ZQ0 7.91e-79 248 42 3 309 3 potA Spermidine/putrescine import ATP-binding protein PotA Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q8FCQ2 8.35e-79 248 40 5 338 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q5HQ70 8.44e-79 248 40 1 303 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q6CZ34 1.19e-78 247 40 6 339 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q2YKZ7 1.34e-78 247 43 1 283 3 BAB2_0493 Putative ATP-binding protein BAB2_0493 Brucella abortus (strain 2308)
Q578M5 1.34e-78 247 43 1 283 3 BruAb2_0487 Putative ATP-binding protein BruAb2_0487 Brucella abortus biovar 1 (strain 9-941)
Q164Y5 1.66e-78 247 40 7 350 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q8XZP8 1.78e-78 248 42 4 290 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q1GB17 1.83e-78 247 38 3 323 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q32EY4 1.96e-78 248 50 0 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella dysenteriae serotype 1 (strain Sd197)
Q3Z2Z3 2.16e-78 248 50 0 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella sonnei (strain Ss046)
Q31ZK0 2.16e-78 248 50 0 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella boydii serotype 4 (strain Sb227)
Q8X6U5 2.28e-78 246 40 5 338 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Escherichia coli O157:H7
Q8F6Z1 2.51e-78 246 38 3 328 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72PE5 2.51e-78 246 38 3 328 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q81GC1 2.55e-78 246 44 2 266 3 potA Spermidine/putrescine import ATP-binding protein PotA Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q7MKU3 3.13e-78 247 49 0 240 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio vulnificus (strain YJ016)
Q8D9J4 3.13e-78 247 49 0 240 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio vulnificus (strain CMCP6)
Q9JZW0 3.15e-78 246 39 3 298 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P69877 3.83e-78 247 50 0 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella flexneri
P69874 3.83e-78 247 50 0 244 1 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli (strain K12)
P69875 3.83e-78 247 50 0 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TIU8 3.83e-78 247 50 0 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P69876 3.83e-78 247 50 0 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O157:H7
P9WQM1 3.84e-78 246 38 5 342 1 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQM0 3.84e-78 246 38 5 342 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A4W3 3.84e-78 246 38 5 342 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q1RD28 3.91e-78 247 50 0 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli (strain UTI89 / UPEC)
A1AA20 3.91e-78 247 50 0 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Escherichia coli O1:K1 / APEC
Q7N6Z2 4.15e-78 246 38 5 343 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q1MCN6 4.34e-78 246 43 2 283 3 ugpC1 sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q0K998 4.43e-78 246 42 3 311 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q04BG2 4.94e-78 246 38 3 323 3 potA Spermidine/putrescine import ATP-binding protein PotA Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q7NQN5 5.7e-78 246 43 2 291 3 potA Spermidine/putrescine import ATP-binding protein PotA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q8CPN0 6.94e-78 246 40 1 303 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q8UB29 8.5e-78 245 44 3 285 3 ugpC3 sn-glycerol-3-phosphate import ATP-binding protein UgpC 3 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q8PC11 1.01e-77 244 40 4 313 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q6MCV4 1.1e-77 245 42 4 288 3 potA Spermidine/putrescine import ATP-binding protein PotA Protochlamydia amoebophila (strain UWE25)
Q722B1 1.13e-77 245 39 4 304 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria monocytogenes serotype 4b (strain F2365)
A0AGP9 1.17e-77 245 39 4 304 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q9I6T2 1.23e-77 245 39 6 353 3 potA1 Spermidine/putrescine import ATP-binding protein PotA 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q87PH3 1.25e-77 245 48 0 241 3 potA Spermidine/putrescine import ATP-binding protein PotA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q66FU4 1.43e-77 244 39 7 352 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Yersinia pseudotuberculosis serotype I (strain IP32953)
Q60AI1 1.47e-77 246 48 0 249 3 potA Spermidine/putrescine import ATP-binding protein PotA Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q73XU8 1.66e-77 244 38 5 339 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q92DL6 1.9e-77 244 39 4 304 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q13ER6 2.25e-77 244 46 5 293 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Rhodopseudomonas palustris (strain BisB5)
Q8D653 2.73e-77 243 47 2 241 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Vibrio vulnificus (strain CMCP6)
Q0TC10 2.74e-77 244 39 5 345 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q7A169 2.76e-77 244 40 2 305 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain MW2)
Q6GAB5 2.76e-77 244 40 2 305 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain MSSA476)
Q6GHY6 2.76e-77 244 40 2 305 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain MRSA252)
Q7A679 2.76e-77 244 40 2 305 1 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain N315)
Q99V03 2.76e-77 244 40 2 305 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HGY5 2.76e-77 244 40 2 305 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain COL)
Q2YX74 2.76e-77 244 40 2 305 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2G2A7 2.76e-77 244 40 2 305 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FHY1 2.76e-77 244 40 2 305 3 potA Spermidine/putrescine import ATP-binding protein PotA Staphylococcus aureus (strain USA300)
Q7MLB8 3.03e-77 244 40 3 302 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Vibrio vulnificus (strain YJ016)
Q92VJ2 3.36e-77 244 48 2 247 3 cysA2 Sulfate/thiosulfate import ATP-binding protein CysA 2 Rhizobium meliloti (strain 1021)
Q0RAT5 3.53e-77 247 38 6 373 3 potA Spermidine/putrescine import ATP-binding protein PotA Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
Q5LX21 3.84e-77 243 44 2 283 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q8Y8T6 4.01e-77 244 39 4 304 3 potA Spermidine/putrescine import ATP-binding protein PotA Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q8FFB3 5.74e-77 243 38 5 339 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q1CNC6 5.88e-77 243 38 7 352 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Yersinia pestis bv. Antiqua (strain Nepal516)
Q74R28 5.88e-77 243 38 7 352 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Yersinia pestis
Q1CBH2 5.88e-77 243 38 7 352 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Yersinia pestis bv. Antiqua (strain Antiqua)
Q8D954 6.39e-77 243 40 3 302 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Vibrio vulnificus (strain CMCP6)
Q6G194 6.5e-77 243 39 5 328 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Bartonella quintana (strain Toulouse)
Q9G4F5 7.44e-77 243 41 1 277 3 CYSA Sulfate/thiosulfate import ATP-binding protein cysA Cucumis sativus
Q9YGA6 7.59e-77 243 45 6 289 1 malK Trehalose/maltose import ATP-binding protein MalK Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C)
Q6G5J0 8.15e-77 242 39 4 321 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q9PDN2 8.42e-77 242 38 5 346 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain 9a5c)
Q4K681 8.93e-77 243 39 7 347 3 potA Spermidine/putrescine import ATP-binding protein PotA Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q1LLP5 1.02e-76 243 39 5 340 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
P63354 1.17e-76 242 47 2 242 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Brucella suis biovar 1 (strain 1330)
P63353 1.17e-76 242 47 2 242 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q87DT9 1.18e-76 242 38 5 346 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q89UD2 1.2e-76 242 38 3 311 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q28QL7 1.24e-76 242 45 1 274 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Jannaschia sp. (strain CCS1)
P16676 1.3e-76 243 46 1 258 1 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli (strain K12)
Q8XBJ8 1.36e-76 242 46 1 258 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Escherichia coli O157:H7
Q668K6 1.48e-76 242 37 6 341 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Yersinia pseudotuberculosis serotype I (strain IP32953)
Q7UC29 1.82e-76 242 46 1 258 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Shigella flexneri
Q65T42 1.88e-76 242 40 4 305 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q5E586 1.92e-76 242 48 0 241 3 potA Spermidine/putrescine import ATP-binding protein PotA Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q1QTX6 2.35e-76 242 46 6 293 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q46ZM0 2.36e-76 242 49 2 241 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A3PRY1 2.67e-76 241 42 2 298 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
Q9KRT4 2.93e-76 242 43 4 282 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q92UV5 3.03e-76 243 44 2 274 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Rhizobium meliloti (strain 1021)
Q6D4E2 3.73e-76 242 48 0 241 3 potA Spermidine/putrescine import ATP-binding protein PotA Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8Z4V6 4.77e-76 241 45 1 258 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhi
P40860 4.97e-76 241 45 1 258 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A1URR2 5.04e-76 240 41 4 313 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q92XW1 5.59e-76 240 43 2 288 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Rhizobium meliloti (strain 1021)
Q93DX8 5.68e-76 237 44 1 247 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) Burkholderia cepacia
Q3IX40 6.9e-76 240 41 2 298 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q1M589 7.3e-76 240 42 2 284 3 ugpC3 sn-glycerol-3-phosphate import ATP-binding protein UgpC 3 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q89WG0 8.82e-76 240 41 5 328 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q8D0W8 9.55e-76 240 37 6 341 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Yersinia pestis
Q6LR20 9.9e-76 240 48 0 241 3 potA Spermidine/putrescine import ATP-binding protein PotA Photobacterium profundum (strain SS9)
Q7VYN2 1.14e-75 240 42 4 297 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WID6 1.15e-75 240 42 4 297 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q2YAD6 1.21e-75 240 45 0 242 3 potA Spermidine/putrescine import ATP-binding protein PotA Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
P40790 1.26e-75 240 49 0 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57QC8 1.26e-75 240 49 0 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella choleraesuis (strain SC-B67)
Q9Z3R9 1.35e-75 240 42 5 313 3 aglK Alpha-glucoside transport ATP-binding protein AglK Rhizobium meliloti (strain 1021)
Q8Z7H7 1.38e-75 240 49 0 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella typhi
Q5PMK1 1.43e-75 240 49 0 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q2K1C8 1.52e-75 239 38 8 353 3 ugpC3 sn-glycerol-3-phosphate import ATP-binding protein UgpC 3 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q2J2E9 1.62e-75 239 41 4 328 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Rhodopseudomonas palustris (strain HaA2)
Q2SSS4 1.81e-75 239 42 0 240 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154)
Q8PNN4 2.04e-75 239 40 5 327 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Xanthomonas axonopodis pv. citri (strain 306)
Q0T5R2 2.5e-75 239 48 0 244 3 potA Spermidine/putrescine import ATP-binding protein PotA Shigella flexneri serotype 5b (strain 8401)
Q9MUN1 2.55e-75 238 39 5 330 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mesostigma viride
Q1QE80 2.7e-75 240 46 0 250 3 potA Spermidine/putrescine import ATP-binding protein PotA Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q6MU19 2.98e-75 238 41 0 240 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasma mycoides subsp. mycoides SC (strain CCUG 32753 / NCTC 10114 / PG1)
Q2L0H5 3.59e-75 239 44 4 290 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Bordetella avium (strain 197N)
Q3KBH4 3.66e-75 239 44 4 290 3 potA Spermidine/putrescine import ATP-binding protein PotA Pseudomonas fluorescens (strain Pf0-1)
Q7W6G5 4.99e-75 238 42 4 297 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P56344 5.25e-75 234 46 0 230 3 cysA Probable sulfate/thiosulfate import ATP-binding protein CysA Chlorella vulgaris
Q2YKR8 5.69e-75 238 45 3 283 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Brucella abortus (strain 2308)
Q8YCB1 6.62e-75 238 45 3 283 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8FW07 6.91e-75 238 45 3 283 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Brucella suis biovar 1 (strain 1330)
Q578E9 6.91e-75 238 45 3 283 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Brucella abortus biovar 1 (strain 9-941)
P31134 6.92e-75 238 39 4 309 1 potG Putrescine transport ATP-binding protein PotG Escherichia coli (strain K12)
Q1M8R6 7.52e-75 237 43 2 278 3 ugpC2 sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q2K6L3 7.62e-75 237 44 2 277 3 ugpC1 sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
A1SWH9 1.03e-74 238 44 5 288 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q9TKX3 1.77e-74 236 47 0 233 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Nephroselmis olivacea
Q92WD6 1.86e-74 236 43 3 289 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Rhizobium meliloti (strain 1021)
D4GP38 2.12e-74 237 43 3 283 1 xacJ Xylose/arabinose import ATP-binding protein XacJ Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q7NRX5 2.64e-74 237 48 2 243 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q6NDQ0 2.95e-74 236 43 3 303 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q8XZX8 3.96e-74 236 46 1 242 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q9KUI0 7.93e-74 236 40 6 320 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q63TY1 1.07e-73 234 43 1 248 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia pseudomallei (strain K96243)
Q62K82 1.13e-73 234 43 1 248 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Burkholderia mallei (strain ATCC 23344)
Q8UII7 2.24e-73 234 41 3 315 3 ugpC1 sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 Agrobacterium fabrum (strain C58 / ATCC 33970)
P9WQI3 5.6e-73 234 44 4 279 1 sugC Trehalose import ATP-binding protein SugC Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WQI2 5.6e-73 234 44 4 279 3 sugC Trehalose import ATP-binding protein SugC Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q3JMW7 6.1e-73 233 40 6 337 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Burkholderia pseudomallei (strain 1710b)
Q9L0Q1 1.83e-72 232 45 3 270 1 msiK Diacetylchitobiose uptake system ATP-binding protein MsiK Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
O32151 3.23e-72 231 41 3 287 3 yurJ Uncharacterized ABC transporter ATP-binding protein YurJ Bacillus subtilis (strain 168)
Q65QT6 3.85e-72 231 37 3 347 3 malK Maltose/maltodextrin import ATP-binding protein MalK Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q7N986 3.85e-72 231 35 5 349 3 malK Maltose/maltodextrin import ATP-binding protein MalK Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q98K23 4.21e-72 230 48 2 245 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q3YUV0 4.44e-72 231 37 5 347 3 malK Maltose/maltodextrin import ATP-binding protein MalK Shigella sonnei (strain Ss046)
Q1R3Q1 4.44e-72 231 37 5 347 1 malK Maltose/maltodextrin import ATP-binding protein MalK Escherichia coli (strain UTI89 / UPEC)
P68187 4.44e-72 231 37 5 347 1 malK Maltose/maltodextrin import ATP-binding protein MalK Escherichia coli (strain K12)
P68188 4.44e-72 231 37 5 347 3 malK Maltose/maltodextrin import ATP-binding protein MalK Escherichia coli O157:H7
Q62GB4 5.38e-72 230 40 6 337 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Burkholderia mallei (strain ATCC 23344)
Q7UBD0 6.2e-72 231 37 4 339 3 malK Maltose/maltodextrin import ATP-binding protein MalK Shigella flexneri
Q63Q62 7.93e-72 230 40 6 337 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Burkholderia pseudomallei (strain K96243)
Q8EBC3 1.17e-71 230 39 4 318 3 cysA1 Sulfate/thiosulfate import ATP-binding protein CysA 1 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q8FB37 1.26e-71 230 36 5 347 3 malK Maltose/maltodextrin import ATP-binding protein MalK Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q7MFC4 1.58e-71 229 39 2 313 3 malK Maltose/maltodextrin import ATP-binding protein MalK Vibrio vulnificus (strain YJ016)
Q8D3V0 1.58e-71 229 39 2 313 3 malK Maltose/maltodextrin import ATP-binding protein MalK Vibrio vulnificus (strain CMCP6)
Q2SU77 2.4e-71 229 44 5 287 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q07UI9 2.45e-71 229 49 1 233 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Rhodopseudomonas palustris (strain BisA53)
P94360 2.49e-71 229 38 4 325 1 msmX Oligosaccharides import ATP-binding protein MsmX Bacillus subtilis (strain 168)
Q0SXQ1 2.57e-71 229 37 4 339 3 malK Maltose/maltodextrin import ATP-binding protein MalK Shigella flexneri serotype 5b (strain 8401)
D4GP39 2.66e-71 229 41 5 294 1 xacK Xylose/arabinose import ATP-binding protein XacK Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
Q0TA26 2.71e-71 229 36 5 347 3 malK Maltose/maltodextrin import ATP-binding protein MalK Escherichia coli O6:K15:H31 (strain 536 / UPEC)
P77795 4.13e-71 227 39 2 322 3 ydcT Uncharacterized ABC transporter ATP-binding protein YdcT Escherichia coli (strain K12)
P55453 4.62e-71 227 37 4 331 3 NGR_a03670 Uncharacterized ABC transporter ATP-binding protein y4fO Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q664X5 5.93e-71 228 37 5 346 3 malK Maltose/maltodextrin import ATP-binding protein MalK Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CNR8 5.93e-71 228 37 5 346 3 malK Maltose/maltodextrin import ATP-binding protein MalK Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZAS8 5.93e-71 228 37 5 346 3 malK Maltose/maltodextrin import ATP-binding protein MalK Yersinia pestis
Q1CC21 5.93e-71 228 37 5 346 3 malK Maltose/maltodextrin import ATP-binding protein MalK Yersinia pestis bv. Antiqua (strain Antiqua)
O83658 9.96e-71 228 47 0 241 3 potA Spermidine/putrescine import ATP-binding protein PotA Treponema pallidum (strain Nichols)
Q79EE4 1.65e-70 227 42 3 282 1 ggtA Osmoprotective compounds uptake ATP-binding protein GgtA Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9KL04 1.66e-70 227 38 2 311 3 malK Maltose/maltodextrin import ATP-binding protein MalK Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q13TV1 2.9e-70 226 46 1 235 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Paraburkholderia xenovorans (strain LB400)
Q82JY6 4.36e-70 225 39 2 302 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q00752 8.54e-70 225 39 4 300 3 msmK Multiple sugar-binding transport ATP-binding protein MsmK Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q9X196 1.14e-69 224 38 3 311 3 potA Spermidine/putrescine import ATP-binding protein PotA Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q87GB5 2.67e-69 224 37 1 311 3 malK Maltose/maltodextrin import ATP-binding protein MalK Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
P19566 3.28e-69 223 36 5 345 1 malK Maltose/maltodextrin import ATP-binding protein MalK Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57GZ7 3.28e-69 223 36 5 345 3 malK Maltose/maltodextrin import ATP-binding protein MalK Salmonella choleraesuis (strain SC-B67)
Q8Z1U0 4.02e-69 223 36 4 337 3 malK Maltose/maltodextrin import ATP-binding protein MalK Salmonella typhi
Q5PKZ8 6.19e-69 223 36 5 345 3 malK Maltose/maltodextrin import ATP-binding protein MalK Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q6LK87 1.08e-68 222 35 2 342 3 malK Maltose/maltodextrin import ATP-binding protein MalK Photobacterium profundum (strain SS9)
Q01937 1.32e-68 222 44 1 243 3 lacK Lactose transport ATP-binding protein LacK Rhizobium radiobacter
P96063 1.53e-68 222 35 5 348 2 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
O86751 2.01e-68 221 35 2 340 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q8Z8W8 2.2e-68 221 46 1 231 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella typhi
Q5PFQ7 2.27e-68 221 46 1 231 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q1BRZ8 7.27e-68 220 45 2 247 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Burkholderia orbicola (strain AU 1054)
A0K3S5 7.27e-68 220 45 2 247 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Burkholderia cenocepacia (strain HI2424)
Q57SD6 1.07e-67 219 35 5 348 3 phnT Putative 2-aminoethylphosphonate import ATP-binding protein PhnT Salmonella choleraesuis (strain SC-B67)
Q0BIZ6 1.15e-67 219 38 4 328 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q8X8K4 2e-67 219 38 2 311 3 ycjV Uncharacterized ABC transporter ATP-binding protein YcjV Escherichia coli O157:H7
Q98G43 5.05e-67 218 40 5 286 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
P18813 5.45e-67 215 40 4 283 3 malK Maltose/maltodextrin import ATP-binding protein MalK (Fragment) Klebsiella aerogenes
Q39KB9 5.6e-67 218 46 1 233 3 ugpC sn-glycerol-3-phosphate import ATP-binding protein UgpC Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q3KCC5 9.93e-67 216 40 4 283 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pseudomonas fluorescens (strain Pf0-1)
P77481 1.29e-66 216 37 2 311 5 ycjV Putative uncharacterized ABC transporter ATP-binding protein YcjV Escherichia coli (strain K12)
Q0TI47 1.42e-66 216 37 2 311 3 ycjV Uncharacterized ABC transporter ATP-binding protein YcjV Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q9A7X1 1.64e-66 216 45 2 241 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q1RC47 2.53e-66 216 37 2 311 4 ycjV Uncharacterized ABC transporter ATP-binding protein YcjV Escherichia coli (strain UTI89 / UPEC)
Q5DZC6 3.86e-66 216 34 3 338 3 malK Maltose/maltodextrin import ATP-binding protein MalK Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q8FHR3 8.34e-66 214 37 2 311 3 ycjV Uncharacterized ABC transporter ATP-binding protein YcjV Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q6D2F6 1.09e-65 214 39 6 318 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q8RI39 2.1e-65 214 37 3 292 3 potA Spermidine/putrescine import ATP-binding protein PotA Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q7CS28 6.2e-65 212 34 4 348 1 smoE Sulfoquinovosyl glycerol transport ATP-binding protein SmoE Agrobacterium fabrum (strain C58 / ATCC 33970)
Q0SBZ1 4.22e-63 207 38 6 308 3 fbpC1 Fe(3+) ions import ATP-binding protein FbpC 1 Rhodococcus jostii (strain RHA1)
Q668Q3 9.5e-63 206 40 6 288 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CJS9 1.01e-62 206 40 6 288 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZCM2 1.01e-62 206 40 6 288 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Yersinia pestis
Q1C607 1.01e-62 206 40 6 288 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Yersinia pestis bv. Antiqua (strain Antiqua)
Q97UY8 1.43e-62 206 36 5 315 1 glcV Glucose import ATP-binding protein GlcV Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Q4KC87 1.35e-61 203 40 7 295 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q0S0Z3 1.88e-61 203 37 6 308 3 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Rhodococcus jostii (strain RHA1)
Q0RYP7 3.5e-61 202 37 6 307 3 fbpC3 Fe(3+) ions import ATP-binding protein FbpC 3 Rhodococcus jostii (strain RHA1)
Q8U4K3 6.05e-59 196 32 4 336 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
P10091 7.63e-59 197 40 0 227 3 cysA Sulfate/thiosulfate import ATP-binding protein CysA Marchantia polymorpha
O57896 1.51e-58 195 35 1 263 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
P44513 1.95e-57 192 32 4 351 1 fbpC2 Fe(3+) ions import ATP-binding protein FbpC 2 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P21410 2.47e-57 192 38 6 297 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Serratia marcescens
Q5JEB0 3.4e-57 191 37 1 262 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q4QP85 6.17e-57 191 32 4 351 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Haemophilus influenzae (strain 86-028NP)
Q5FA19 1.68e-56 190 37 3 282 1 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q45460 1.73e-56 191 38 3 242 2 opuBA Choline transport ATP-binding protein OpuBA Bacillus subtilis (strain 168)
Q56927 2.91e-56 189 38 4 287 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Yersinia enterocolitica
O34992 8.51e-56 189 37 2 247 1 opuCA Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA Bacillus subtilis (strain 168)
Q9V2C0 9.18e-56 188 31 3 320 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Pyrococcus abyssi (strain GE5 / Orsay)
Q4W575 1.16e-55 188 37 3 282 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JVH1 1.16e-55 188 37 3 282 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P46920 2.98e-55 189 38 1 239 1 opuAA Glycine betaine transport ATP-binding protein OpuAA Bacillus subtilis (strain 168)
Q9RR46 3.91e-55 188 35 2 273 1 gbuA Glycine betaine/carnitine transport ATP-binding protein GbuA Listeria monocytogenes serotype 1/2a (strain 10403S)
Q85A69 1.2e-54 186 38 0 233 2 cysA Sulfate/thiosulfate import ATP-binding protein CysA Anthoceros angustus
A0A0H2ZLL3 2.23e-54 181 38 2 237 3 egtUA Probable ergothioneine transport ATP-binding protein EgtUA Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q9KIF7 4.25e-54 186 39 2 241 3 opuAA Glycine betaine transport ATP-binding protein OpuAA Lactococcus lactis subsp. lactis (strain IL1403)
P10346 1e-51 174 39 3 237 1 glnQ Glutamine transport ATP-binding protein GlnQ Escherichia coli (strain K12)
Q50966 1.69e-51 177 35 3 282 3 fbpC Fe(3+) ions import ATP-binding protein FbpC Neisseria gonorrhoeae
Q8ZPK4 1.09e-50 176 38 3 242 1 osmV Osmoprotectant import ATP-binding protein OsmV Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E0SCY1 1.57e-50 176 36 1 231 1 ousV Glycine betaine/choline transport system ATP-binding protein OusV Dickeya dadantii (strain 3937)
Q9KHT9 3.25e-50 175 38 2 232 1 opuCA Carnitine transport ATP-binding protein OpuCA Listeria monocytogenes
G2JZ44 3.25e-50 175 38 2 232 1 opuCA Carnitine transport ATP-binding protein OpuCA Listeria monocytogenes serotype 1/2a (strain 10403S)
Q87UI3 5.62e-49 168 44 2 209 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48CA0 7.58e-49 168 43 2 207 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
P14175 8.51e-49 171 34 1 233 1 proV Glycine betaine/proline betaine transport system ATP-binding protein ProV Escherichia coli (strain K12)
P17328 9.36e-49 171 34 1 233 2 proV Glycine betaine/proline betaine transport system ATP-binding protein ProV Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q6YPR6 3.73e-48 170 41 1 205 3 potA Spermidine/putrescine import ATP-binding protein PotA Onion yellows phytoplasma (strain OY-M)
Q6YPR6 5.94e-21 96 40 0 97 3 potA Spermidine/putrescine import ATP-binding protein PotA Onion yellows phytoplasma (strain OY-M)
P55662 5.35e-48 165 38 3 242 3 NGR_a01510 Probable amino-acid ABC transporter ATP-binding protein y4tH Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q2NK31 6.18e-48 169 40 1 209 3 potA Spermidine/putrescine import ATP-binding protein PotA Aster yellows witches'-broom phytoplasma (strain AYWB)
Q2NK31 5.71e-22 99 41 0 97 3 potA Spermidine/putrescine import ATP-binding protein PotA Aster yellows witches'-broom phytoplasma (strain AYWB)
Q0SFY5 7.26e-48 167 33 7 307 3 metN1 Methionine import ATP-binding protein MetN 1 Rhodococcus jostii (strain RHA1)
P37774 1.41e-47 164 39 5 246 1 tcyN L-cystine transport system ATP-binding protein TcyN Escherichia coli (strain K12)
Q4ZLS1 3.14e-46 161 41 2 209 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Pseudomonas syringae pv. syringae (strain B728a)
Q7VM95 5.28e-46 162 34 3 260 3 metN Methionine import ATP-binding protein MetN Haemophilus ducreyi (strain 35000HP / ATCC 700724)
Q3K506 5.28e-46 160 42 3 212 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas fluorescens (strain Pf0-1)
Q67SV5 2.51e-45 160 36 2 240 3 metN Methionine import ATP-binding protein MetN Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q2SY12 2.69e-45 160 35 2 243 3 metN Methionine import ATP-binding protein MetN Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q65VG9 2.7e-45 160 35 3 256 3 metN Methionine import ATP-binding protein MetN Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q89LP2 2.7e-45 160 34 4 245 3 metN Methionine import ATP-binding protein MetN Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q6D1C4 3.01e-45 160 36 3 263 3 metN3 Methionine import ATP-binding protein MetN 3 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q4FL37 6.14e-45 160 35 1 221 1 tmoW Trimethylamine N-oxide transport system ATP-binding protein TmoW Pelagibacter ubique (strain HTCC1062)
Q1CDR0 6.56e-45 157 42 3 216 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis bv. Antiqua (strain Nepal516)
Q74PI5 6.56e-45 157 42 3 216 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis
Q1C1S0 6.56e-45 157 42 3 216 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pestis bv. Antiqua (strain Antiqua)
Q63S19 6.95e-45 160 35 2 243 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia pseudomallei (strain K96243)
Q3JPZ4 6.95e-45 160 35 2 243 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia pseudomallei (strain 1710b)
Q62M41 6.95e-45 160 35 2 243 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia mallei (strain ATCC 23344)
Q9CK97 9.75e-45 159 34 3 257 3 metN Methionine import ATP-binding protein MetN Pasteurella multocida (strain Pm70)
Q3M5J9 1.18e-44 156 41 3 210 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q8FV85 1.25e-44 159 36 2 242 3 metN Methionine import ATP-binding protein MetN Brucella suis biovar 1 (strain 1330)
Q8YD40 1.25e-44 159 36 2 242 3 metN Methionine import ATP-binding protein MetN Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q579H8 1.25e-44 159 36 2 242 3 metN Methionine import ATP-binding protein MetN Brucella abortus biovar 1 (strain 9-941)
Q2YIV5 1.25e-44 159 36 2 242 3 metN Methionine import ATP-binding protein MetN Brucella abortus (strain 2308)
Q0TLD2 1.41e-44 159 35 3 241 3 metN Methionine import ATP-binding protein MetN Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q3Z5F8 1.56e-44 159 35 3 241 3 metN Methionine import ATP-binding protein MetN Shigella sonnei (strain Ss046)
Q1RFY9 1.56e-44 159 35 3 241 3 metN Methionine import ATP-binding protein MetN Escherichia coli (strain UTI89 / UPEC)
P63355 1.56e-44 159 35 3 241 3 metN Methionine import ATP-binding protein MetN Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P63356 1.56e-44 159 35 3 241 3 metN Methionine import ATP-binding protein MetN Escherichia coli O157:H7
Q5LT65 1.65e-44 159 36 1 218 1 tmoW Trimethylamine N-oxide transport system ATP-binding protein TmoW Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q88R93 1.83e-44 156 42 2 206 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q0S6U9 2.13e-44 155 39 4 237 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Rhodococcus jostii (strain RHA1)
P30750 2.41e-44 158 35 3 241 1 metN Methionine import ATP-binding protein MetN Escherichia coli (strain K12)
Q665B6 2.56e-44 156 42 3 216 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Yersinia pseudotuberculosis serotype I (strain IP32953)
Q4K441 2.71e-44 156 42 3 207 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
P45769 3.22e-44 155 35 3 237 3 yhdZ Uncharacterized amino-acid ABC transporter ATP-binding protein YhdZ Escherichia coli (strain K12)
Q6A6X6 3.24e-44 158 35 3 238 3 metN Methionine import ATP-binding protein MetN Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q32JQ8 3.31e-44 158 35 3 241 3 metN Methionine import ATP-binding protein MetN Shigella dysenteriae serotype 1 (strain Sd197)
Q1RDS4 3.45e-44 155 44 2 207 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli (strain UTI89 / UPEC)
A1A9L0 3.45e-44 155 44 2 207 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli O1:K1 / APEC
Q5WKL3 3.9e-44 158 33 4 264 3 metN1 Methionine import ATP-binding protein MetN 1 Shouchella clausii (strain KSM-K16)
Q13VD7 4.18e-44 157 35 2 243 3 metN1 Methionine import ATP-binding protein MetN 1 Paraburkholderia xenovorans (strain LB400)
Q58762 4.5e-44 156 36 4 232 3 wtpC Molybdate/tungstate import ATP-binding protein WtpC Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q0BMC9 4.81e-44 157 34 2 241 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. holarctica (strain OSU18)
Q2A3Z2 4.81e-44 157 34 2 241 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. holarctica (strain LVS)
Q0I5E9 5.4e-44 157 37 4 243 3 metN Methionine import ATP-binding protein MetN Histophilus somni (strain 129Pt)
Q02QT1 6.28e-44 155 41 2 207 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Pseudomonas aeruginosa (strain UCBPP-PA14)
Q0TJC1 7.12e-44 154 45 4 207 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q8ELQ6 8.07e-44 157 36 3 241 3 metN3 Methionine import ATP-binding protein MetN 3 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q325U1 1.11e-43 156 35 3 241 3 metN Methionine import ATP-binding protein MetN Shigella boydii serotype 4 (strain Sb227)
Q5NFU5 1.12e-43 157 34 2 241 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q57855 1.37e-43 154 38 3 212 3 MJ0412 Uncharacterized ABC transporter ATP-binding protein MJ0412 Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q6LV32 1.37e-43 153 34 1 226 3 thiQ Thiamine import ATP-binding protein ThiQ Photobacterium profundum (strain SS9)
Q83MC5 1.43e-43 156 35 3 241 3 metN Methionine import ATP-binding protein MetN Shigella flexneri
Q0T810 1.43e-43 156 35 3 241 3 metN Methionine import ATP-binding protein MetN Shigella flexneri serotype 5b (strain 8401)
Q9HYG4 1.5e-43 154 41 2 207 3 ssuB1 Aliphatic sulfonates import ATP-binding protein SsuB 1 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q5WBL0 1.64e-43 153 39 2 209 3 ssuB3 Aliphatic sulfonates import ATP-binding protein SsuB 3 Shouchella clausii (strain KSM-K16)
Q81C68 1.91e-43 153 38 3 211 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8KZQ6 1.92e-43 154 43 2 202 1 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas putida
Q14H97 2.26e-43 156 34 2 241 3 metN Methionine import ATP-binding protein MetN Francisella tularensis subsp. tularensis (strain FSC 198)
Q73YZ5 2.47e-43 153 39 1 210 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QFE1 2.47e-43 153 39 1 210 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Mycobacterium avium (strain 104)
Q8U648 2.53e-43 153 42 3 210 3 ssuB2 Aliphatic sulfonates import ATP-binding protein SsuB 2 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q0K9I2 3.1e-43 154 39 1 209 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q6N9W0 3.63e-43 156 35 1 221 3 metN1 Methionine import ATP-binding protein MetN 1 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q1BY14 4.07e-43 155 34 3 255 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia orbicola (strain AU 1054)
A0K5N5 4.07e-43 155 34 3 255 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia cenocepacia (strain HI2424)
Q87SV4 4.91e-43 152 39 0 217 3 thiQ Thiamine import ATP-binding protein ThiQ Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q6NJ07 5.09e-43 155 35 3 240 3 metN Methionine import ATP-binding protein MetN Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Q6CYU2 5.66e-43 152 40 2 215 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q5NN23 5.99e-43 151 41 2 209 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q89ER4 6.28e-43 152 42 4 213 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q6HP89 6.34e-43 154 37 2 222 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q8TUR7 6.75e-43 152 36 6 247 3 pstB Phosphate import ATP-binding protein PstB Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)
Q92L31 6.79e-43 151 35 1 214 3 thiQ Thiamine import ATP-binding protein ThiQ Rhizobium meliloti (strain 1021)
Q8RQL7 6.82e-43 151 35 3 238 3 gluA Glutamate transport ATP-binding protein GluA Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q8FJ95 7.01e-43 152 44 2 207 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0BH79 7.66e-43 154 35 4 255 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q21XJ9 8.02e-43 152 40 5 231 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q5KVK2 8.3e-43 154 36 2 226 3 metN Methionine import ATP-binding protein MetN Geobacillus kaustophilus (strain HTA426)
Q8EUR3 8.41e-43 159 38 4 221 3 potA Spermidine/putrescine import ATP-binding protein PotA Malacoplasma penetrans (strain HF-2)
Q8EUR3 5.28e-24 106 44 1 106 3 potA Spermidine/putrescine import ATP-binding protein PotA Malacoplasma penetrans (strain HF-2)
Q81IN8 8.6e-43 154 37 2 222 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q8NQU4 9.09e-43 151 34 3 247 1 argV Arginine transport ATP-binding protein ArgV Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q81IZ6 9.3e-43 154 34 3 254 3 metN1 Methionine import ATP-binding protein MetN 1 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81ZF5 1.01e-42 154 37 2 222 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus anthracis
Q39IE7 1.05e-42 154 34 3 255 3 metN1 Methionine import ATP-binding protein MetN 1 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q4JTG9 1.07e-42 154 35 1 218 3 metN Methionine import ATP-binding protein MetN Corynebacterium jeikeium (strain K411)
Q7NB11 1.17e-42 157 37 4 224 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q7NB11 7.51e-26 111 44 1 119 3 potA Spermidine/putrescine import ATP-binding protein PotA Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
Q1IGL4 1.71e-42 151 41 2 205 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Pseudomonas entomophila (strain L48)
Q6AE21 1.82e-42 153 33 3 242 3 metN Methionine import ATP-binding protein MetN Leifsonia xyli subsp. xyli (strain CTCB07)
Q5HIL5 2.05e-42 153 34 3 241 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain COL)
Q2G0V2 2.05e-42 153 34 3 241 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJI0 2.05e-42 153 34 3 241 3 metN1 Methionine import ATP-binding protein MetN 1 Staphylococcus aureus (strain USA300)
Q07LQ4 2.2e-42 151 42 3 207 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Rhodopseudomonas palustris (strain BisA53)
Q21BU8 2.36e-42 153 34 4 247 3 metN Methionine import ATP-binding protein MetN Rhodopseudomonas palustris (strain BisB18)
Q73EL7 2.68e-42 153 36 2 222 3 metN2 Methionine import ATP-binding protein MetN 2 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q8RFN2 2.92e-42 152 32 2 238 3 metN Methionine import ATP-binding protein MetN Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q3Z3I7 3.17e-42 150 43 3 210 3 ssuB Aliphatic sulfonates import ATP-binding protein SsuB Shigella sonnei (strain Ss046)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS00905
Feature type CDS
Gene fbpC
Product ferric ABC transporter ATP-binding protein
Location 223039 - 224079 (strand: -1)
Length 1041 (nucleotides) / 346 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_299
Orthogroup size 8
N. genomes 7

Actions

Genomic region

Domains

PF00005 ABC transporter
PF08402 TOBE domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3842 Amino acid transport and metabolism (E) E ABC-type Fe3+/spermidine/putrescine transport systems, ATPase component

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02010 iron(III) transport system ATP-binding protein [EC:7.2.2.7] ABC transporters -

Protein Sequence

MTQSHFVELKNIVKRFGTNTVIDTLSLSIPQGKMVSLLGPSGCGKTTVLRLVAGLEKPTEGKIFIDGEDVTDRSIQQRDICMVFQSYALFPHMSLGDNIGYGLKMLGRPKAEIKQRVAEALALVDLAGFEDRFVDQISGGQQQRVALARALILKPKVLLFDEPLSNLDANLRRSMREKIRELQQQFNITSLYVTHDQSEAFAVSDMVLVMNKGKIMQLGSPQTLYRQPASEFMASFMGDANLFPATLGADYVDIFNYRLPRPENFNSNKTEIRVGVRPEAITLSQQGEACQQCTIIHVAYMGPQYEVTVAWQNQTLLLQVNATQLQPNEGDSYYLQIHPYGMFILE

Flanking regions ( +/- flanking 50bp)

GTGTTTCACGCTCTAAAGCCAAAAATGCACAGTAATACGGAGTATAAATCATGACACAATCACATTTCGTTGAACTGAAAAATATTGTTAAGCGTTTTGGTACAAACACGGTAATTGACACTCTCAGTTTATCTATTCCTCAAGGAAAAATGGTTTCGTTATTGGGGCCATCAGGTTGCGGTAAAACGACAGTACTACGCTTAGTAGCTGGATTAGAAAAACCAACAGAAGGTAAAATTTTTATTGATGGTGAAGATGTTACTGATCGCTCAATCCAACAACGTGATATTTGTATGGTGTTTCAGTCTTACGCCCTGTTCCCTCATATGTCTTTAGGTGACAACATTGGTTATGGCTTAAAAATGTTAGGTCGCCCAAAGGCAGAGATCAAACAGCGAGTGGCAGAGGCTCTAGCCTTGGTAGATTTAGCAGGATTTGAAGATCGTTTTGTCGATCAGATTTCAGGCGGTCAGCAACAACGAGTGGCATTAGCTCGTGCTTTGATCTTAAAACCCAAAGTGCTGTTATTTGATGAGCCATTAAGTAATCTGGATGCTAACTTGCGCCGTAGCATGAGGGAGAAAATTCGTGAATTACAACAACAGTTTAATATCACCTCCCTGTATGTTACCCATGACCAAAGTGAAGCTTTTGCCGTTTCCGATATGGTGTTAGTGATGAATAAAGGCAAAATAATGCAATTAGGTTCACCACAAACTTTATATCGCCAACCGGCCTCTGAGTTTATGGCAAGTTTTATGGGAGATGCCAATCTCTTCCCTGCTACTCTAGGGGCTGATTATGTTGATATTTTTAATTATCGCTTACCTCGCCCCGAGAACTTTAACAGCAACAAAACCGAAATTAGAGTGGGTGTCAGACCTGAAGCTATTACCTTATCTCAACAAGGTGAAGCTTGTCAGCAATGTACAATAATCCATGTCGCCTATATGGGACCACAATATGAGGTGACTGTTGCATGGCAAAATCAAACATTGTTATTACAAGTGAATGCAACCCAACTTCAACCTAATGAAGGTGATAGCTATTATCTACAAATCCATCCTTATGGGATGTTTATCTTAGAATAATGGCTTTTATTTTAGTGAGTGAGGCACCCAATGGGTGCCTCTTTTTTTAT