Homologs in group_1300

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07955 FBDBKF_07955 80.3 Morganella morganii S1 hpt hypoxanthine phosphoribosyltransferase
EHELCC_13785 EHELCC_13785 80.3 Morganella morganii S2 hpt hypoxanthine phosphoribosyltransferase
NLDBIP_14230 NLDBIP_14230 80.3 Morganella morganii S4 hpt hypoxanthine phosphoribosyltransferase
LHKJJB_08620 LHKJJB_08620 80.3 Morganella morganii S3 hpt hypoxanthine phosphoribosyltransferase
HKOGLL_08170 HKOGLL_08170 80.3 Morganella morganii S5 hpt hypoxanthine phosphoribosyltransferase
F4V73_RS13030 F4V73_RS13030 79.8 Morganella psychrotolerans hpt hypoxanthine phosphoribosyltransferase

Distribution of the homologs in the orthogroup group_1300

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1300

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
O33799 5.4e-102 293 77 1 180 1 hpt Hypoxanthine phosphoribosyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A9M4 9.45e-102 293 78 1 180 3 hpt Hypoxanthine phosphoribosyltransferase Shigella flexneri
P0A9M2 9.45e-102 293 78 1 180 1 hpt Hypoxanthine phosphoribosyltransferase Escherichia coli (strain K12)
P0A9M3 9.45e-102 293 78 1 180 3 hpt Hypoxanthine phosphoribosyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P18134 2.48e-90 264 70 1 175 3 hpt Hypoxanthine phosphoribosyltransferase Vibrio harveyi
P45078 4.76e-81 241 65 1 176 3 hpt Hypoxanthine phosphoribosyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8K9U8 3.49e-77 231 62 1 177 3 hpt Hypoxanthine phosphoribosyltransferase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57291 1.5e-74 224 61 2 178 3 hpt Hypoxanthine phosphoribosyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P37171 5.77e-66 202 54 1 177 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q839B2 4.49e-57 180 52 2 172 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Enterococcus faecalis (strain ATCC 700802 / V583)
Q8CQV4 3.14e-52 167 48 1 172 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRP4 3.14e-52 167 48 1 172 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q54NJ8 3.38e-52 167 46 2 173 1 hprT Hypoxanthine-guanine phosphoribosyltransferase Dictyostelium discoideum
Q724J4 8.27e-52 178 48 1 170 3 tilS/hprT Bifunctional protein TilS/HprT Listeria monocytogenes serotype 4b (strain F2365)
Q8YAC7 9.55e-52 178 48 1 170 3 tilS/hprT Bifunctional protein TilS/HprT Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q92F56 1.09e-51 178 49 1 170 3 tilS/hprT Bifunctional protein TilS/HprT Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P65828 9.52e-51 164 47 1 168 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Staphylococcus aureus (strain MW2)
Q6GBX8 9.52e-51 164 47 1 168 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Staphylococcus aureus (strain MSSA476)
Q6GJG1 9.52e-51 164 47 1 168 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Staphylococcus aureus (strain MRSA252)
P99085 9.52e-51 164 47 1 168 1 hpt Hypoxanthine-guanine phosphoribosyltransferase Staphylococcus aureus (strain N315)
P65827 9.52e-51 164 47 1 168 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HIG5 9.52e-51 164 47 1 168 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Staphylococcus aureus (strain COL)
P37472 1.04e-50 164 54 3 174 3 hprT Hypoxanthine-guanine phosphoribosyltransferase Bacillus subtilis (strain 168)
Q8DWM8 5.3e-49 159 43 1 172 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q8E2H3 9.23e-49 159 44 1 167 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E7Y1 9.23e-49 159 44 1 167 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus agalactiae serotype III (strain NEM316)
P96794 1.14e-48 159 50 1 172 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Mycobacterium avium
Q5M6K8 1.83e-47 155 41 1 172 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M216 1.83e-47 155 41 1 172 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus thermophilus (strain CNRZ 1066)
O66821 4.38e-47 154 45 1 160 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Aquifex aeolicus (strain VF5)
O69537 7.29e-47 155 48 1 175 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Mycobacterium leprae (strain TN)
Q8DRP8 1.66e-46 153 43 1 170 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97TC4 1.66e-46 153 43 1 170 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P9WHQ9 2.94e-46 153 48 1 172 1 hpt Hypoxanthine-guanine phosphoribosyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P0A5T1 2.94e-46 153 48 1 172 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WHQ8 6.71e-46 152 48 1 172 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q02522 3.28e-41 140 47 3 172 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Lactococcus lactis subsp. lactis (strain IL1403)
P0DD41 1.99e-40 137 44 2 170 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus pyogenes serotype M3 (strain SSI-1)
Q7CNQ9 1.99e-40 137 44 2 170 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XEL6 1.99e-40 137 44 2 170 1 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DD40 1.99e-40 137 44 2 170 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P51900 4.96e-40 137 40 3 168 1 HPT Hypoxanthine-guanine-xanthine phosphoribosyltransferase Tritrichomonas foetus
P43152 1.49e-36 129 40 2 167 3 None Hypoxanthine-guanine phosphoribosyltransferase Leishmania donovani
Q27541 5.33e-34 122 37 2 168 3 HGPRT Hypoxanthine-guanine phosphoribosyltransferase Crithidia fasciculata
P75119 3.99e-31 114 30 1 170 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q07010 7.32e-31 114 37 2 169 1 HGPRT Hypoxanthine-guanine phosphoribosyltransferase Trypanosoma brucei brucei
P47696 8.45e-28 105 29 0 158 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q9W719 2.53e-24 97 35 5 185 2 HPRT1 Hypoxanthine-guanine phosphoribosyltransferase Gallus gallus
Q3SZ18 5.01e-24 97 34 5 184 2 HPRT1 Hypoxanthine-guanine phosphoribosyltransferase Bos taurus
P27605 7.99e-24 96 34 5 184 1 Hprt1 Hypoxanthine-guanine phosphoribosyltransferase Rattus norvegicus
Q45FY6 9.58e-24 96 34 5 184 2 HPRT1 Hypoxanthine-guanine phosphoribosyltransferase Sus scrofa
Q6WIT9 1.01e-23 95 34 5 184 2 HPRT1 Hypoxanthine-guanine phosphoribosyltransferase Canis lupus familiaris
P00493 1.03e-23 95 34 5 184 1 Hprt1 Hypoxanthine-guanine phosphoribosyltransferase Mus musculus
Q64531 1.08e-23 95 34 5 184 1 Hprt1 Hypoxanthine-guanine phosphoribosyltransferase (Fragment) Mus spretus
Q6LDD9 1.18e-23 95 34 5 184 2 HPRT1 Hypoxanthine-guanine phosphoribosyltransferase Macaca fascicularis
P00492 1.18e-23 95 34 5 184 1 HPRT1 Hypoxanthine-guanine phosphoribosyltransferase Homo sapiens
P47959 2.04e-23 95 34 5 184 2 HPRT1 Hypoxanthine-guanine phosphoribosyltransferase Meriones unguiculatus
A5A6I1 2.44e-23 95 34 5 184 2 HPRT1 Hypoxanthine-guanine phosphoribosyltransferase Pan troglodytes
P00494 5.29e-22 91 34 4 176 2 HPRT1 Hypoxanthine-guanine phosphoribosyltransferase Cricetulus griseus
P07833 5.62e-18 81 31 5 191 2 LACZ Hypoxanthine-guanine-xanthine phosphoribosyltransferase Plasmodium falciparum (isolate K1 / Thailand)
P20035 5.68e-18 81 31 5 191 1 LACZ Hypoxanthine-guanine-xanthine phosphoribosyltransferase Plasmodium falciparum (isolate FCR-3 / Gambia)
P09383 7.42e-17 79 28 4 183 1 HGPRT Hypoxanthine-guanine phosphoribosyltransferase Schistosoma mansoni
Q9NRG1 5.74e-15 73 29 5 184 1 PRTFDC1 Phosphoribosyltransferase domain-containing protein 1 Homo sapiens
Q6DCP3 7.09e-14 70 30 4 153 2 prtfdc1 Phosphoribosyltransferase domain-containing protein 1 Xenopus laevis
A4II60 1.79e-13 68 30 3 145 2 prtfdc1 Phosphoribosyltransferase domain-containing protein 1 Xenopus tropicalis
Q26997 4.28e-13 68 28 4 180 1 HPRT Hypoxanthine-guanine-xanthine phosphoribosyltransferase Toxoplasma gondii
Q5QW45 3.69e-06 48 28 10 174 3 gpt Xanthine-guanine phosphoribosyltransferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q0SRX5 4.94e-05 45 25 5 155 3 pyrR Bifunctional protein PyrR Clostridium perfringens (strain SM101 / Type A)
Q8XJB2 4.94e-05 45 25 5 155 3 pyrR Bifunctional protein PyrR Clostridium perfringens (strain 13 / Type A)
Q0TPA8 4.94e-05 45 25 5 155 3 pyrR Bifunctional protein PyrR Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q87RV3 5.36e-05 44 29 6 117 3 gpt Xanthine-guanine phosphoribosyltransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q311U1 6.6e-05 44 31 4 100 3 gpt Xanthine-guanine phosphoribosyltransferase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
B7VJB5 9.08e-05 44 35 5 91 3 gpt Xanthine-guanine phosphoribosyltransferase Vibrio atlanticus (strain LGP32)
A7MWU9 9.64e-05 44 29 6 117 3 gpt Xanthine-guanine phosphoribosyltransferase Vibrio campbellii (strain ATCC BAA-1116)
Q7MN62 9.74e-05 43 33 5 95 3 gpt Xanthine-guanine phosphoribosyltransferase Vibrio vulnificus (strain YJ016)
Q8DF90 9.74e-05 43 33 5 95 3 gpt Xanthine-guanine phosphoribosyltransferase Vibrio vulnificus (strain CMCP6)
C3LQ49 0.000114 43 28 6 114 3 gpt Xanthine-guanine phosphoribosyltransferase Vibrio cholerae serotype O1 (strain M66-2)
Q9KPT5 0.000114 43 28 6 114 3 gpt Xanthine-guanine phosphoribosyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F5Y8 0.000114 43 28 6 114 3 gpt Xanthine-guanine phosphoribosyltransferase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
B9DU60 0.000177 43 25 7 151 3 pyrR Bifunctional protein PyrR Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q7N7B4 0.000206 43 28 6 114 3 gpt Xanthine-guanine phosphoribosyltransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A1VES8 0.000269 43 28 4 100 3 gpt Xanthine-guanine phosphoribosyltransferase Nitratidesulfovibrio vulgaris (strain DP4)
Q9CF77 0.000284 43 27 7 152 3 pyrR Pyrimidine operon regulatory protein Lactococcus lactis subsp. lactis (strain IL1403)
Q02XW4 0.000289 43 27 7 152 3 pyrR Bifunctional protein PyrR Lactococcus lactis subsp. cremoris (strain SK11)
Q9L4N8 0.000289 43 27 7 152 3 pyrR Pyrimidine operon regulatory protein Lactococcus lactis subsp. cremoris (strain MG1363)
B4EUU7 0.000292 42 29 6 114 3 gpt Xanthine-guanine phosphoribosyltransferase Proteus mirabilis (strain HI4320)
A8GAD0 0.000306 42 27 6 114 3 gpt Xanthine-guanine phosphoribosyltransferase Serratia proteamaculans (strain 568)
Q72D63 0.000718 41 28 4 100 3 gpt Xanthine-guanine phosphoribosyltransferase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A0Q074 0.000819 42 23 6 151 3 pyrR Bifunctional protein PyrR Clostridium novyi (strain NT)
Q5E6W3 0.000897 41 29 3 77 3 gpt Xanthine-guanine phosphoribosyltransferase Aliivibrio fischeri (strain ATCC 700601 / ES114)
A2RF64 0.001 41 22 6 151 3 pyrR Bifunctional protein PyrR Streptococcus pyogenes serotype M5 (strain Manfredo)
P0DD75 0.001 41 22 6 151 3 pyrR Bifunctional protein PyrR Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48U73 0.001 41 22 6 151 3 pyrR Bifunctional protein PyrR Streptococcus pyogenes serotype M28 (strain MGAS6180)
Q1J796 0.001 41 22 6 151 3 pyrR Bifunctional protein PyrR Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JMD0 0.001 41 22 6 151 3 pyrR Bifunctional protein PyrR Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JCF0 0.001 41 22 6 151 3 pyrR Bifunctional protein PyrR Streptococcus pyogenes serotype M12 (strain MGAS2096)
P0DD74 0.001 41 22 6 151 3 pyrR Bifunctional protein PyrR Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS00775
Feature type CDS
Gene hpt
Product hypoxanthine phosphoribosyltransferase
Location 197442 - 197984 (strand: 1)
Length 543 (nucleotides) / 180 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_1300
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00156 Phosphoribosyl transferase domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0634 Nucleotide transport and metabolism (F) F Hypoxanthine-guanine phosphoribosyltransferase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00760 hypoxanthine phosphoribosyltransferase [EC:2.4.2.8] Purine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Biosynthesis of secondary metabolites
Nucleotide metabolism		 -

Protein Sequence

MKHIVDVMISEEEIKQRIAELGREITEHYRSRQEKHDLVLIGLLKGSFIFMADLCREIEVPHEVDFMTVSSYGNGMTSTRDVKIIKDLDEDIRGKDVLIVEDIIDSGNTLNRVKEILSLREPASIAICTLLDKPSRREVDVPVEWIGYSIEDKFVIGYGIDYAQRYRHLPYIGHVTLLDE

Flanking regions ( +/- flanking 50bp)

AATTCTGGTACAATCGGTTGCTTTCCCCGTTAACCCAATCGAAATAAATCATGAAACATATTGTTGATGTCATGATCTCTGAAGAAGAGATCAAACAGCGTATTGCTGAATTAGGTCGTGAAATCACAGAACATTATCGTTCTCGTCAAGAAAAACACGATTTGGTCTTAATTGGCTTATTAAAAGGCTCTTTTATTTTTATGGCGGATTTATGTCGTGAAATTGAAGTGCCACATGAAGTCGATTTTATGACAGTATCAAGTTACGGTAATGGAATGACGTCAACAAGAGACGTTAAAATCATTAAAGATCTTGATGAAGACATTCGTGGTAAAGATGTTCTGATTGTTGAAGATATTATTGACTCAGGTAATACTTTAAACCGTGTTAAAGAGATTTTAAGTTTACGTGAGCCTGCCTCTATTGCTATCTGTACGCTACTTGATAAGCCATCACGTCGTGAAGTGGATGTGCCAGTAGAGTGGATTGGCTACTCTATTGAAGATAAGTTTGTTATAGGTTACGGCATTGATTATGCACAACGTTATCGTCACCTACCTTATATTGGTCATGTAACGCTACTAGATGAATAATCTTGTTGATTTATATCGTATATTAAAAAACCCGCTTTGGCGGGTTTAAT