Homologs in group_1300

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_07955 FBDBKF_07955 96.1 Morganella morganii S1 hpt hypoxanthine phosphoribosyltransferase
EHELCC_13785 EHELCC_13785 96.1 Morganella morganii S2 hpt hypoxanthine phosphoribosyltransferase
NLDBIP_14230 NLDBIP_14230 96.1 Morganella morganii S4 hpt hypoxanthine phosphoribosyltransferase
LHKJJB_08620 LHKJJB_08620 96.1 Morganella morganii S3 hpt hypoxanthine phosphoribosyltransferase
HKOGLL_08170 HKOGLL_08170 96.1 Morganella morganii S5 hpt hypoxanthine phosphoribosyltransferase
PMI_RS00775 PMI_RS00775 79.8 Proteus mirabilis HI4320 hpt hypoxanthine phosphoribosyltransferase

Distribution of the homologs in the orthogroup group_1300

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1300

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A9M4 2.23e-95 277 74 0 177 3 hpt Hypoxanthine phosphoribosyltransferase Shigella flexneri
P0A9M2 2.23e-95 277 74 0 177 1 hpt Hypoxanthine phosphoribosyltransferase Escherichia coli (strain K12)
P0A9M3 2.23e-95 277 74 0 177 3 hpt Hypoxanthine phosphoribosyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
O33799 1.67e-94 275 72 0 177 1 hpt Hypoxanthine phosphoribosyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P18134 6.18e-83 245 66 1 172 3 hpt Hypoxanthine phosphoribosyltransferase Vibrio harveyi
P45078 1.71e-77 231 62 1 179 3 hpt Hypoxanthine phosphoribosyltransferase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8K9U8 7.81e-77 230 62 0 174 3 hpt Hypoxanthine phosphoribosyltransferase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57291 9.34e-75 224 62 1 175 3 hpt Hypoxanthine phosphoribosyltransferase Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P37171 8.96e-64 197 53 1 171 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q8CQV4 5.57e-52 167 49 1 172 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRP4 5.57e-52 167 49 1 172 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q839B2 5.93e-52 167 49 1 172 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Enterococcus faecalis (strain ATCC 700802 / V583)
Q54NJ8 2.48e-51 165 47 2 171 1 hprT Hypoxanthine-guanine phosphoribosyltransferase Dictyostelium discoideum
P65828 1.44e-50 163 48 1 166 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Staphylococcus aureus (strain MW2)
Q6GBX8 1.44e-50 163 48 1 166 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Staphylococcus aureus (strain MSSA476)
Q6GJG1 1.44e-50 163 48 1 166 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Staphylococcus aureus (strain MRSA252)
P99085 1.44e-50 163 48 1 166 1 hpt Hypoxanthine-guanine phosphoribosyltransferase Staphylococcus aureus (strain N315)
P65827 1.44e-50 163 48 1 166 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HIG5 1.44e-50 163 48 1 166 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Staphylococcus aureus (strain COL)
Q92F56 4.42e-50 173 50 1 164 3 tilS/hprT Bifunctional protein TilS/HprT Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q8E2H3 7.35e-50 162 48 1 164 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E7Y1 7.35e-50 162 48 1 164 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus agalactiae serotype III (strain NEM316)
Q8YAC7 2.75e-49 171 48 1 164 3 tilS/hprT Bifunctional protein TilS/HprT Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q724J4 2.84e-49 171 48 1 164 3 tilS/hprT Bifunctional protein TilS/HprT Listeria monocytogenes serotype 4b (strain F2365)
Q8DWM8 3.34e-49 160 45 1 172 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q8DRP8 9.74e-47 154 46 1 164 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q97TC4 9.74e-47 154 46 1 164 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P37472 2.57e-46 152 49 2 173 3 hprT Hypoxanthine-guanine phosphoribosyltransferase Bacillus subtilis (strain 168)
Q5M6K8 1.01e-45 151 43 1 172 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M216 1.01e-45 151 43 1 172 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus thermophilus (strain CNRZ 1066)
O66821 1.06e-45 151 46 1 160 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Aquifex aeolicus (strain VF5)
O69537 1.85e-44 149 50 1 170 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Mycobacterium leprae (strain TN)
P96794 5.03e-43 145 50 1 168 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Mycobacterium avium
P0DD41 1.27e-42 143 46 1 164 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus pyogenes serotype M3 (strain SSI-1)
Q7CNQ9 1.27e-42 143 46 1 164 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XEL6 1.27e-42 143 46 1 164 1 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DD40 1.27e-42 143 46 1 164 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P9WHQ9 2.36e-42 143 49 1 168 1 hpt Hypoxanthine-guanine phosphoribosyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P0A5T1 2.36e-42 143 49 1 168 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
P9WHQ8 4.24e-42 142 48 1 168 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Q02522 6.02e-42 141 47 2 151 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Lactococcus lactis subsp. lactis (strain IL1403)
P51900 6.34e-39 134 38 3 165 1 HPT Hypoxanthine-guanine-xanthine phosphoribosyltransferase Tritrichomonas foetus
P43152 5.54e-33 119 38 3 175 3 None Hypoxanthine-guanine phosphoribosyltransferase Leishmania donovani
Q07010 3.88e-31 115 39 2 168 1 HGPRT Hypoxanthine-guanine phosphoribosyltransferase Trypanosoma brucei brucei
P75119 6e-30 110 34 1 158 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
Q27541 6.17e-30 112 35 3 168 3 HGPRT Hypoxanthine-guanine phosphoribosyltransferase Crithidia fasciculata
P47696 6.26e-28 105 31 1 164 3 hpt Hypoxanthine-guanine phosphoribosyltransferase Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
Q45FY6 2.31e-21 89 37 4 153 2 HPRT1 Hypoxanthine-guanine phosphoribosyltransferase Sus scrofa
P27605 2.36e-21 89 37 4 153 1 Hprt1 Hypoxanthine-guanine phosphoribosyltransferase Rattus norvegicus
Q6WIT9 2.39e-21 89 37 4 153 2 HPRT1 Hypoxanthine-guanine phosphoribosyltransferase Canis lupus familiaris
Q3SZ18 2.8e-21 89 37 4 153 2 HPRT1 Hypoxanthine-guanine phosphoribosyltransferase Bos taurus
Q6LDD9 2.95e-21 89 37 4 153 2 HPRT1 Hypoxanthine-guanine phosphoribosyltransferase Macaca fascicularis
P00492 2.95e-21 89 37 4 153 1 HPRT1 Hypoxanthine-guanine phosphoribosyltransferase Homo sapiens
P00493 3.04e-21 89 37 4 153 1 Hprt1 Hypoxanthine-guanine phosphoribosyltransferase Mus musculus
Q64531 3.11e-21 89 37 4 153 1 Hprt1 Hypoxanthine-guanine phosphoribosyltransferase (Fragment) Mus spretus
Q9W719 4.14e-21 89 37 3 145 2 HPRT1 Hypoxanthine-guanine phosphoribosyltransferase Gallus gallus
P47959 5.11e-21 89 37 5 153 2 HPRT1 Hypoxanthine-guanine phosphoribosyltransferase Meriones unguiculatus
A5A6I1 6.94e-21 88 37 4 153 2 HPRT1 Hypoxanthine-guanine phosphoribosyltransferase Pan troglodytes
P00494 1.91e-19 84 37 3 145 2 HPRT1 Hypoxanthine-guanine phosphoribosyltransferase Cricetulus griseus
Q9NRG1 1.51e-14 72 29 2 173 1 PRTFDC1 Phosphoribosyltransferase domain-containing protein 1 Homo sapiens
P07833 3.29e-14 71 30 3 179 2 LACZ Hypoxanthine-guanine-xanthine phosphoribosyltransferase Plasmodium falciparum (isolate K1 / Thailand)
P20035 3.33e-14 71 30 3 179 1 LACZ Hypoxanthine-guanine-xanthine phosphoribosyltransferase Plasmodium falciparum (isolate FCR-3 / Gambia)
P09383 8.36e-14 70 30 3 173 1 HGPRT Hypoxanthine-guanine phosphoribosyltransferase Schistosoma mansoni
Q6DCP3 1.63e-12 66 30 3 148 2 prtfdc1 Phosphoribosyltransferase domain-containing protein 1 Xenopus laevis
A4II60 5.67e-12 65 30 3 148 2 prtfdc1 Phosphoribosyltransferase domain-containing protein 1 Xenopus tropicalis
Q26997 8.56e-12 64 30 5 177 1 HPRT Hypoxanthine-guanine-xanthine phosphoribosyltransferase Toxoplasma gondii
Q1GHI7 1.94e-05 46 32 5 106 3 gpt Xanthine-guanine phosphoribosyltransferase Ruegeria sp. (strain TM1040)
Q163Y8 3.88e-05 45 30 6 135 3 gpt Xanthine-guanine phosphoribosyltransferase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q5QW45 6.43e-05 44 26 6 141 3 gpt Xanthine-guanine phosphoribosyltransferase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q28PG8 0.000175 43 30 3 109 3 gpt Xanthine-guanine phosphoribosyltransferase Jannaschia sp. (strain CCS1)
A1VES8 0.000401 42 27 4 100 3 gpt Xanthine-guanine phosphoribosyltransferase Nitratidesulfovibrio vulgaris (strain DP4)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS13030
Feature type CDS
Gene hpt
Product hypoxanthine phosphoribosyltransferase
Location 219930 - 220469 (strand: -1)
Length 540 (nucleotides) / 179 (amino acids)

Contig

Accession term accessions NZ_VXKB01000003 accessions NZ_VXKB01000000 Name: value, dtype: object
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1300
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00156 Phosphoribosyl transferase domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0634 Nucleotide transport and metabolism (F) F Hypoxanthine-guanine phosphoribosyltransferase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00760 hypoxanthine phosphoribosyltransferase [EC:2.4.2.8] Purine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Biosynthesis of secondary metabolites
Nucleotide metabolism		 -

Protein Sequence

MKKHTLDTMISEAEIQQRVAGLGSEISAHYRHSDKDLVLVGLLKGSFIFMADLCRKIDVPHEVDFMTVSSYGSGTSSTRDVKIVKDLDEDIRGKDVLIVEDIIDSGNTLHRVRDILSLRGPNSVSICTLLDKPCRREVNVPVEWVGYAIEDKFVVGYGIDYAQSYRHLPYIGHVTLLEE

Flanking regions ( +/- flanking 50bp)

TGTTTAATACTGAACCACTGTAACAGCGTAGCGTTGACGGCAAAAAAATCATGAAGAAACATACCTTAGATACAATGATCTCCGAAGCGGAGATTCAGCAGCGTGTTGCCGGACTCGGCAGTGAAATTTCCGCACACTATCGTCACAGCGATAAAGATCTGGTTTTAGTCGGATTGCTGAAAGGCTCTTTTATTTTTATGGCTGATTTATGCCGTAAAATTGATGTTCCGCATGAAGTGGATTTTATGACCGTATCCAGCTACGGCAGCGGCACATCCTCCACCCGTGATGTGAAAATTGTCAAAGATCTGGATGAAGATATCCGTGGCAAAGATGTGCTGATCGTGGAAGATATTATTGATTCCGGTAATACATTGCATCGTGTGCGCGATATTCTCTCTCTGCGCGGCCCGAACTCTGTATCTATCTGCACTCTGCTGGATAAACCCTGCCGCCGTGAAGTGAATGTACCGGTGGAGTGGGTGGGTTATGCAATTGAAGATAAATTTGTGGTGGGTTATGGCATCGATTATGCCCAGAGCTACCGCCACCTGCCGTATATCGGGCATGTGACACTGCTGGAAGAGTAATTTTCTGCACAATTATTCAGCCGGAAATTACTTATCCGGGAGTTACTTAC