Homologs in group_3865

Help

1 homologs were identified in 1 genome with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
F4V73_RS13165 F4V73_RS13165 85.1 Morganella psychrotolerans pepT peptidase T

Distribution of the homologs in the orthogroup group_3865

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3865

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q8R922 3.47e-118 353 42 6 410 3 pepT Peptidase T Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A0Q3I1 2.46e-117 351 42 5 406 3 pepT Peptidase T Clostridium novyi (strain NT)
C5DAS5 6.45e-117 350 43 5 410 3 pepT Peptidase T Geobacillus sp. (strain WCH70)
B8CWQ0 2.62e-116 348 43 5 410 3 pepT Peptidase T Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562)
Q5KZ39 7.42e-116 347 44 4 410 3 pepT Peptidase T Geobacillus kaustophilus (strain HTA426)
A5HYY2 2.95e-115 345 43 4 411 3 pepT Peptidase T Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FPG2 2.95e-115 345 43 4 411 3 pepT Peptidase T Clostridium botulinum (strain ATCC 19397 / Type A)
B1KV00 4.31e-115 345 43 4 411 3 pepT Peptidase T Clostridium botulinum (strain Loch Maree / Type A3)
C1FSB0 4.51e-115 345 43 4 411 3 pepT Peptidase T Clostridium botulinum (strain Kyoto / Type A2)
A4INW9 5.65e-115 345 43 5 410 3 pepT Peptidase T Geobacillus thermodenitrificans (strain NG80-2)
A7GAK0 1.09e-114 344 42 4 411 3 pepT Peptidase T Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
Q65D74 1.45e-114 344 44 5 410 3 pepT Peptidase T Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
C3L049 1.73e-114 343 42 4 411 3 pepT Peptidase T Clostridium botulinum (strain 657 / Type Ba4)
Q89YZ7 5.66e-114 342 42 5 412 3 pepT Peptidase T Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
B1IEF5 1.02e-113 342 42 4 411 3 pepT Peptidase T Clostridium botulinum (strain Okra / Type B1)
Q8ZH96 5.7e-113 340 43 5 402 3 YPO1009 Peptidase T-like protein YPO1009/y3403/YP_3421 Yersinia pestis
A8ML45 1.22e-112 339 43 6 409 3 pepT Peptidase T Alkaliphilus oremlandii (strain OhILAs)
A6L8T2 3.57e-111 335 41 5 411 3 pepT Peptidase T Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q92VT5 3.84e-111 335 45 5 407 3 RB0614 Peptidase T-like protein RB0614 Rhizobium meliloti (strain 1021)
A8FIY2 5.86e-111 335 40 5 410 3 pepT Peptidase T Bacillus pumilus (strain SAFR-032)
P58794 1.13e-110 334 43 4 407 3 pepT Peptidase T Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q0SWT9 1.74e-110 333 43 5 408 3 pepT Peptidase T Clostridium perfringens (strain SM101 / Type A)
Q71YN8 1.23e-109 331 42 5 410 3 pepT Peptidase T Listeria monocytogenes serotype 4b (strain F2365)
B1YFS8 1.27e-109 331 41 6 417 3 pepT Peptidase T Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
B8DDX7 1.28e-109 331 42 5 410 3 pepT Peptidase T Listeria monocytogenes serotype 4a (strain HCC23)
Q5WK52 2.7e-109 330 42 5 409 3 pepT Peptidase T Shouchella clausii (strain KSM-K16)
P55179 2.79e-109 330 41 5 405 3 pepT Peptidase T Bacillus subtilis (strain 168)
Q8CXN0 4.4e-109 330 40 4 409 3 pepT Peptidase T Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
C1KW79 4.69e-109 330 42 5 410 3 pepT Peptidase T Listeria monocytogenes serotype 4b (strain CLIP80459)
Q8XPD8 6.23e-109 329 42 5 408 3 pepT Peptidase T Clostridium perfringens (strain 13 / Type A)
Q64WS4 8.26e-109 329 41 4 412 3 pepT Peptidase T Bacteroides fragilis (strain YCH46)
Q5LFT7 8.26e-109 329 41 4 412 3 pepT Peptidase T Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q0TV42 1.21e-108 328 42 5 408 3 pepT Peptidase T Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q8Y6B1 1.34e-108 328 42 5 410 3 pepT Peptidase T Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q92AM8 2.38e-108 328 41 5 410 3 pepT Peptidase T Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A0AJN4 4.14e-108 327 41 5 410 3 pepT Peptidase T Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
A7ZAB2 7.69e-108 327 41 5 410 3 pepT Peptidase T Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
B8G1J0 7.65e-107 324 41 6 413 3 pepT Peptidase T Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
A7GR91 1.05e-106 324 40 5 410 3 pepT Peptidase T Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q24VU3 5.87e-106 322 41 6 413 3 pepT Peptidase T Desulfitobacterium hafniense (strain Y51)
Q97LS8 8.73e-105 319 40 5 410 3 pepT Peptidase T Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
C4L0I9 1.74e-104 318 39 4 410 3 pepT Peptidase T Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
A9KT72 7.47e-104 316 40 5 409 3 pepT Peptidase T Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q5E0X3 9.15e-104 316 42 4 408 3 pepT Peptidase T Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q732Y5 6.85e-103 314 40 5 405 3 pepT Peptidase T Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JJ20 7.31e-103 314 40 5 405 3 pepT Peptidase T Bacillus cereus (strain AH820)
B6ER23 1e-102 313 42 6 408 3 pepT Peptidase T Aliivibrio salmonicida (strain LFI1238)
Q6HF68 1.06e-102 313 40 5 410 3 pepT Peptidase T Bacillus thuringiensis subsp. konkukian (strain 97-27)
B7ITJ6 1.19e-102 313 40 5 405 3 pepT Peptidase T Bacillus cereus (strain G9842)
A9VR36 1.2e-102 313 40 5 405 3 pepT Peptidase T Bacillus mycoides (strain KBAB4)
B7HDL9 1.46e-102 313 40 5 405 3 pepT Peptidase T Bacillus cereus (strain B4264)
C1ENW4 1.94e-102 313 40 5 405 3 pepT Peptidase T Bacillus cereus (strain 03BB102)
A0RHB6 1.94e-102 313 40 5 405 3 pepT Peptidase T Bacillus thuringiensis (strain Al Hakam)
C0ZDI3 3.22e-102 312 41 5 410 3 pepT Peptidase T Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q636T5 3.25e-102 312 40 5 405 3 pepT Peptidase T Bacillus cereus (strain ZK / E33L)
B7HKU6 4e-102 312 40 5 405 3 pepT Peptidase T Bacillus cereus (strain AH187)
B9IV41 4.21e-102 312 40 5 405 3 pepT Peptidase T Bacillus cereus (strain Q1)
Q81A48 5.06e-102 312 40 5 405 3 pepT Peptidase T Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81WU4 8.54e-102 311 40 5 405 1 pepT Peptidase T Bacillus anthracis
C3L855 8.54e-102 311 40 5 405 3 pepT Peptidase T Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P5E3 8.54e-102 311 40 5 405 3 pepT Peptidase T Bacillus anthracis (strain A0248)
B7VSC8 3.15e-96 297 39 6 411 3 pepT Peptidase T Vibrio atlanticus (strain LGP32)
A0KIP7 1.97e-95 295 38 7 409 3 pepT Peptidase T Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q6LR24 6.22e-95 293 38 6 412 3 pepT Peptidase T Photobacterium profundum (strain SS9)
Q7MDF5 9.69e-95 293 38 7 415 3 pepT Peptidase T Vibrio vulnificus (strain YJ016)
Q87GX2 1.37e-94 293 38 6 413 3 pepT Peptidase T Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q1WTV4 3.15e-94 292 39 7 413 3 pepT Peptidase T Ligilactobacillus salivarius (strain UCC118)
Q38X92 5.7e-93 288 38 5 411 3 pepT Peptidase T Latilactobacillus sakei subsp. sakei (strain 23K)
A8H6S3 1.73e-91 285 38 6 410 3 pepT Peptidase T Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B9EAD7 5.92e-91 283 40 7 400 3 pepT Peptidase T Macrococcus caseolyticus (strain JCSC5402)
B1HZ48 6.16e-91 283 38 6 415 3 pepT Peptidase T Lysinibacillus sphaericus (strain C3-41)
B0TPD4 1.55e-90 282 38 7 411 3 pepT Peptidase T Shewanella halifaxensis (strain HAW-EB4)
C5BFN3 2.89e-90 281 38 9 414 3 pepT Peptidase T Edwardsiella ictaluri (strain 93-146)
Q6D4E3 2.54e-89 279 38 9 414 3 pepT Peptidase T Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A4SPD7 4.48e-89 278 36 7 409 3 pepT Peptidase T Aeromonas salmonicida (strain A449)
B1JI59 4.83e-89 278 39 8 411 3 pepT Peptidase T Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
B9DK09 5.28e-89 278 38 6 410 3 pepT Peptidase T Staphylococcus carnosus (strain TM300)
Q9KMY6 5.7e-89 278 39 6 412 3 pepT Peptidase T Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B9DU35 1.71e-88 277 35 7 407 3 pepT Peptidase T Streptococcus uberis (strain ATCC BAA-854 / 0140J)
Q4L4G8 1.75e-88 277 39 8 406 3 pepT Peptidase T Staphylococcus haemolyticus (strain JCSC1435)
C3LUK2 6.17e-88 276 39 6 412 3 pepT Peptidase T Vibrio cholerae serotype O1 (strain M66-2)
A5EYJ8 6.17e-88 276 39 6 412 3 pepT Peptidase T Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
C6DFW1 9.5e-88 275 37 9 414 3 pepT Peptidase T Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q669P7 9.89e-88 275 38 8 411 3 pepT Peptidase T Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TLP0 9.89e-88 275 38 8 411 3 pepT Peptidase T Yersinia pestis (strain Pestoides F)
Q1CI51 9.89e-88 275 38 8 411 3 pepT Peptidase T Yersinia pestis bv. Antiqua (strain Nepal516)
A9R0M2 9.89e-88 275 38 8 411 3 pepT Peptidase T Yersinia pestis bv. Antiqua (strain Angola)
Q8ZFR0 9.89e-88 275 38 8 411 3 pepT Peptidase T Yersinia pestis
B2K719 9.89e-88 275 38 8 411 3 pepT Peptidase T Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C6R3 9.89e-88 275 38 8 411 3 pepT Peptidase T Yersinia pestis bv. Antiqua (strain Antiqua)
A7FH54 1.27e-87 275 38 8 411 3 pepT Peptidase T Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q6GIP8 1.09e-86 272 38 8 418 3 pepT Peptidase T Staphylococcus aureus (strain MRSA252)
B5BAE8 3.23e-86 271 37 9 413 3 pepT Peptidase T Salmonella paratyphi A (strain AKU_12601)
Q5PMK2 3.23e-86 271 37 9 413 3 pepT Peptidase T Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TTK0 3.26e-86 271 37 9 413 3 pepT Peptidase T Salmonella schwarzengrund (strain CVM19633)
B5F8C6 3.26e-86 271 37 9 413 3 pepT Peptidase T Salmonella agona (strain SL483)
B5FK77 5.3e-86 271 37 9 413 3 pepT Peptidase T Salmonella dublin (strain CT_02021853)
Q8NXM6 6.11e-86 270 38 8 418 3 pepT Peptidase T Staphylococcus aureus (strain MW2)
A8Z018 6.11e-86 270 38 8 418 3 pepT Peptidase T Staphylococcus aureus (strain USA300 / TCH1516)
Q6GB87 6.11e-86 270 38 8 418 3 pepT Peptidase T Staphylococcus aureus (strain MSSA476)
A6QF52 6.11e-86 270 38 8 418 3 pepT Peptidase T Staphylococcus aureus (strain Newman)
Q5HHS7 6.11e-86 270 38 8 418 3 pepT Peptidase T Staphylococcus aureus (strain COL)
Q2G064 6.11e-86 270 38 8 418 3 pepT Peptidase T Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIP8 6.11e-86 270 38 8 418 3 pepT Peptidase T Staphylococcus aureus (strain USA300)
B1KHS7 6.28e-86 270 37 6 411 3 pepT Peptidase T Shewanella woodyi (strain ATCC 51908 / MS32)
B5XKT3 7.86e-86 270 36 7 406 3 pepT Peptidase T Streptococcus pyogenes serotype M49 (strain NZ131)
P65806 1.01e-85 270 38 8 418 3 pepT Peptidase T Staphylococcus aureus (strain N315)
P65805 1.01e-85 270 38 8 418 3 pepT Peptidase T Staphylococcus aureus (strain Mu50 / ATCC 700699)
A5IQU7 1.01e-85 270 38 8 418 3 pepT Peptidase T Staphylococcus aureus (strain JH9)
A6TZM2 1.01e-85 270 38 8 418 3 pepT Peptidase T Staphylococcus aureus (strain JH1)
A7WZN6 1.01e-85 270 38 8 418 3 pepT Peptidase T Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q2YSI6 1.04e-85 270 38 8 418 3 pepT Peptidase T Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q49VU2 1.88e-85 269 38 8 407 3 pepT Peptidase T Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q1JHK2 2.68e-85 269 36 7 406 3 pepT Peptidase T Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q8P1H9 2.68e-85 269 36 7 406 3 pepT Peptidase T Streptococcus pyogenes serotype M18 (strain MGAS8232)
B5RB75 2.97e-85 269 37 9 413 3 pepT Peptidase T Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q57QC7 2.97e-85 269 37 9 413 3 pepT Peptidase T Salmonella choleraesuis (strain SC-B67)
P26311 3.2e-85 268 37 9 413 1 pepT Peptidase T Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
B4T3R6 3.2e-85 268 37 9 413 3 pepT Peptidase T Salmonella newport (strain SL254)
B4TFK5 3.2e-85 268 37 9 413 3 pepT Peptidase T Salmonella heidelberg (strain SL476)
Q8CWX9 3.6e-85 268 34 5 404 3 pepT Peptidase T Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
B7LQ18 3.61e-85 268 36 9 413 3 pepT Peptidase T Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q48U99 3.91e-85 268 36 7 406 3 pepT Peptidase T Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RF89 4.95e-85 268 36 7 406 3 pepT Peptidase T Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J7C3 4.95e-85 268 36 7 406 3 pepT Peptidase T Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JMF5 5.01e-85 268 36 7 406 3 pepT Peptidase T Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JCH7 5.01e-85 268 36 7 406 3 pepT Peptidase T Streptococcus pyogenes serotype M12 (strain MGAS2096)
P0DD01 5.82e-85 268 36 7 406 3 pepT Peptidase T Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DD00 5.82e-85 268 36 7 406 3 pepT Peptidase T Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q8E4E2 9.28e-85 267 36 8 405 3 pepT Peptidase T Streptococcus agalactiae serotype III (strain NEM316)
B6I9K6 9.91e-85 267 36 9 413 3 pepT Peptidase T Escherichia coli (strain SE11)
Q835J5 1e-84 267 36 5 411 3 pepT Peptidase T Enterococcus faecalis (strain ATCC 700802 / V583)
Q8Z7H6 1.02e-84 267 37 9 413 3 pepT Peptidase T Salmonella typhi
P29745 1.03e-84 267 36 9 413 1 pepT Peptidase T Escherichia coli (strain K12)
B1XA37 1.03e-84 267 36 9 413 3 pepT Peptidase T Escherichia coli (strain K12 / DH10B)
C4ZS67 1.03e-84 267 36 9 413 3 pepT Peptidase T Escherichia coli (strain K12 / MC4100 / BW2952)
A7ZKR7 1.14e-84 267 36 9 413 3 pepT Peptidase T Escherichia coli O139:H28 (strain E24377A / ETEC)
B5QXA9 1.2e-84 267 37 9 413 3 pepT Peptidase T Salmonella enteritidis PT4 (strain P125109)
Q9CP05 1.21e-84 267 37 9 409 3 pepT Peptidase T Pasteurella multocida (strain Pm70)
Q9L4G1 1.49e-84 267 36 6 412 1 pepT Peptidase T Lactobacillus helveticus
Q3Z2Z2 1.53e-84 267 36 9 413 3 pepT Peptidase T Shigella sonnei (strain Ss046)
Q32EY5 1.53e-84 267 36 9 413 3 pepT Peptidase T Shigella dysenteriae serotype 1 (strain Sd197)
Q1RD26 1.53e-84 267 36 9 413 3 pepT Peptidase T Escherichia coli (strain UTI89 / UPEC)
B7N3N7 1.53e-84 267 36 9 413 3 pepT Peptidase T Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P65803 1.53e-84 267 36 9 413 3 pepT Peptidase T Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1AA21 1.53e-84 267 36 9 413 3 pepT Peptidase T Escherichia coli O1:K1 / APEC
B7MTQ8 1.53e-84 267 36 9 413 3 pepT Peptidase T Escherichia coli O81 (strain ED1a)
P65804 1.53e-84 267 36 9 413 3 pepT Peptidase T Escherichia coli O157:H7
B7MJB5 1.53e-84 267 36 9 413 3 pepT Peptidase T Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UQ36 1.53e-84 267 36 9 413 3 pepT Peptidase T Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q31ZK3 1.82e-84 266 36 9 413 3 pepT Peptidase T Shigella boydii serotype 4 (strain Sb227)
B2TZ80 1.82e-84 266 36 9 413 3 pepT Peptidase T Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q83RR6 1.96e-84 266 36 9 413 3 pepT Peptidase T Shigella flexneri
Q0T5R1 1.96e-84 266 36 9 413 3 pepT Peptidase T Shigella flexneri serotype 5b (strain 8401)
Q8DYT4 2.04e-84 266 36 8 405 3 pepT Peptidase T Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
B1IUE0 2.07e-84 266 36 9 413 3 pepT Peptidase T Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZZ82 2.07e-84 266 36 9 413 3 pepT Peptidase T Escherichia coli O9:H4 (strain HS)
Q9A0F4 4.91e-84 265 35 7 406 3 pepT Peptidase T Streptococcus pyogenes serotype M1
Q0TIU6 5.51e-84 265 36 9 413 3 pepT Peptidase T Escherichia coli O6:K15:H31 (strain 536 / UPEC)
C0Q764 5.98e-84 265 36 9 413 3 pepT Peptidase T Salmonella paratyphi C (strain RKS4594)
Q5XCU7 7.47e-84 265 35 7 406 3 pepT Peptidase T Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q3K0C3 1.61e-83 264 36 8 405 3 pepT Peptidase T Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
A8GDC2 2.53e-83 264 36 8 411 3 pepT Peptidase T Serratia proteamaculans (strain 568)
A9MG86 5.39e-83 263 36 8 413 3 pepT Peptidase T Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A8AHU0 7.13e-83 263 36 9 413 3 pepT Peptidase T Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q4QK58 2.15e-82 261 37 7 406 3 pepT Peptidase T Haemophilus influenzae (strain 86-028NP)
B2GC19 2.29e-82 261 36 7 410 3 pepT Peptidase T Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
A5UEI5 3.21e-82 261 37 7 406 3 pepT Peptidase T Haemophilus influenzae (strain PittGG)
Q8CPZ6 3.38e-82 261 37 7 408 3 pepT Peptidase T Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQY6 3.38e-82 261 37 7 408 3 pepT Peptidase T Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
P45172 4.06e-82 261 37 7 406 3 pepT Peptidase T Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A8G0I7 7.65e-82 260 38 8 412 3 pepT Peptidase T Shewanella sediminis (strain HAW-EB3)
C1CE02 1.36e-81 259 35 6 405 3 pepT Peptidase T Streptococcus pneumoniae (strain JJA)
B5XSP2 1.92e-81 259 35 9 414 3 pepT Peptidase T Klebsiella pneumoniae (strain 342)
C1C6Y4 1.98e-81 259 35 6 405 3 pepT Peptidase T Streptococcus pneumoniae (strain 70585)
C1CK88 2.05e-81 259 35 6 405 3 pepT Peptidase T Streptococcus pneumoniae (strain P1031)
B2IPG2 2.49e-81 258 35 6 405 3 pepT Peptidase T Streptococcus pneumoniae (strain CGSP14)
A5UBV7 4.09e-81 258 37 8 406 3 pepT Peptidase T Haemophilus influenzae (strain PittEE)
Q97R31 4.3e-81 258 35 6 405 3 pepT Peptidase T Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B1IBG7 5.17e-81 258 35 6 405 3 pepT Peptidase T Streptococcus pneumoniae (strain Hungary19A-6)
C0MGM6 5.39e-81 258 34 7 406 3 pepT Peptidase T Streptococcus equi subsp. zooepidemicus (strain H70)
C0M8H1 5.39e-81 258 34 7 406 3 pepT Peptidase T Streptococcus equi subsp. equi (strain 4047)
C1CRC4 6.62e-81 257 35 6 405 3 pepT Peptidase T Streptococcus pneumoniae (strain Taiwan19F-14)
Q84BV2 6.62e-81 258 35 6 410 1 pepT Peptidase T Lactococcus lactis subsp. hordniae
B8ZPG1 1.45e-80 256 35 6 405 3 pepT Peptidase T Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
Q8DQ05 1.49e-80 256 34 4 405 3 pepT Peptidase T Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
Q04KS5 1.49e-80 256 34 4 405 3 pepT Peptidase T Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
Q76HM5 3.11e-80 256 35 6 410 1 pepT Peptidase T Lactococcus lactis subsp. lactis
Q9CEM7 3.11e-80 256 35 6 410 3 pepT Peptidase T Lactococcus lactis subsp. lactis (strain IL1403)
P0C2T7 3.77e-80 256 35 6 410 1 pepT Peptidase T Lactococcus lactis subsp. cremoris
Q02X44 3.98e-80 256 35 6 410 3 pepT Peptidase T Lactococcus lactis subsp. cremoris (strain SK11)
A2RMN0 3.98e-80 256 35 6 410 3 pepT Peptidase T Lactococcus lactis subsp. cremoris (strain MG1363)
Q76HM7 3.98e-80 256 35 6 410 1 pepT Peptidase T Lactococcus lactis subsp. cremoris
A4VVF5 9.3e-79 252 34 6 404 3 pepT Peptidase T Streptococcus suis (strain 05ZYH33)
A4W1Q9 9.3e-79 252 34 6 404 3 pepT Peptidase T Streptococcus suis (strain 98HAH33)
A3CNH0 9.06e-77 247 34 5 404 3 pepT Peptidase T Streptococcus sanguinis (strain SK36)
A8AXT3 2.84e-76 245 33 5 404 3 pepT Peptidase T Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q03KI4 4.43e-76 245 35 7 405 3 pepT Peptidase T Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M465 2.16e-75 243 35 7 405 3 pepT Peptidase T Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LZL2 2.16e-75 243 35 7 405 3 pepT Peptidase T Streptococcus thermophilus (strain CNRZ 1066)
P54542 4.19e-17 85 25 6 284 3 yqjE Uncharacterized protein YqjE Bacillus subtilis (strain 168)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS00710
Feature type CDS
Gene pepT
Product peptidase T
Location 182893 - 184146 (strand: -1)
Length 1254 (nucleotides) / 417 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_3865
Orthogroup size 2
N. genomes 2

Actions

Genomic region

Domains

PF01546 Peptidase family M20/M25/M40
PF07687 Peptidase dimerisation domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2195 Amino acid transport and metabolism (E) E Di- or tripeptidase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K01258 tripeptide aminopeptidase [EC:3.4.11.4] - -

Protein Sequence

MNIVDRFISYTKVNTTTNRENGAAGIMPSSEGQRVLALQLVEELKALGVEDIKIRDTAIVTATLPSNLDYEVPTVAFFGHLDTSAEQTNDTKAQILPYKGGDLCLNKELEIFLRQSEFPELENYIGDDIIVTDGTSLLGADDKAAIASIMDMLQYFKQHPEVKHGTVKIGFVPDEEQGLRGAKAFDVTEFGADFAYTLDCCGIGELVYENWNAGDVEITFIGTSAHPMSAKGKLKNSLLMAHKFIAMLPGGEAPEYTEGREGYYWVKQLAGNSARTVLKMDVRDFTEAGYAHRMAFLKQLSEQCEALWGEGTVVCKQADRYANVFNSLQGENRYPIDIAIDAYKANGITPRPIPMRGGYDGAALSQKGLPCPNIFTGAHNFHSIYEYLPVKSLYAASDVLKSVVKITAERFAPGAKA

Flanking regions ( +/- flanking 50bp)

ACAACAGAATTTTATTAAATAAAATACAAAAAACACAACGGAGTCTAATCATGAACATTGTTGATCGGTTTATTTCTTACACCAAGGTGAATACTACAACAAATAGAGAAAATGGCGCAGCGGGGATTATGCCTTCATCGGAAGGTCAGCGAGTCCTCGCTTTACAATTAGTCGAAGAGTTAAAGGCGTTAGGTGTTGAAGATATCAAAATTCGCGATACTGCCATTGTTACCGCGACACTACCTTCTAACCTTGATTATGAGGTTCCTACCGTGGCTTTCTTTGGTCACTTAGATACCAGTGCAGAACAAACTAATGATACTAAAGCACAAATTTTACCTTATAAAGGTGGCGACCTTTGCTTAAACAAAGAACTTGAGATTTTTTTACGTCAAAGTGAATTCCCTGAATTAGAAAACTATATTGGTGACGATATCATCGTAACAGATGGTACTAGCTTATTAGGCGCTGACGACAAAGCGGCTATCGCCTCTATTATGGATATGTTGCAATATTTTAAACAACATCCAGAAGTGAAACACGGTACAGTTAAAATTGGTTTTGTACCCGATGAAGAGCAAGGTTTACGTGGTGCAAAAGCCTTTGATGTAACAGAATTCGGCGCAGACTTTGCTTATACCTTAGATTGTTGTGGTATTGGTGAACTTGTATATGAAAATTGGAATGCCGGTGATGTTGAAATAACCTTTATCGGAACCTCAGCACACCCTATGTCAGCAAAAGGTAAATTAAAAAATTCACTGTTAATGGCTCATAAATTTATTGCGATGTTACCGGGCGGTGAAGCACCGGAATATACTGAAGGTCGTGAAGGTTATTATTGGGTAAAACAACTGGCGGGTAATAGCGCACGTACTGTATTAAAAATGGATGTGCGTGATTTCACAGAAGCAGGCTACGCCCATCGTATGGCATTTTTAAAACAACTTTCAGAGCAATGTGAAGCGTTATGGGGTGAAGGGACTGTTGTTTGTAAGCAAGCCGATCGTTATGCAAATGTCTTTAATAGTCTACAAGGTGAAAATCGATATCCTATCGATATTGCTATTGATGCTTATAAAGCCAATGGTATTACCCCTCGTCCAATCCCTATGCGGGGTGGCTATGATGGAGCAGCATTATCGCAAAAAGGATTACCTTGCCCTAATATCTTTACCGGGGCGCACAATTTCCACTCTATTTATGAATATCTTCCCGTTAAATCGCTTTATGCTGCCAGCGATGTATTGAAATCTGTCGTTAAGATCACCGCAGAGCGTTTTGCACCCGGAGCTAAAGCATGATCCAAATTCTTGCGGTCTTAATTGTCGTTATTATTGTCGCTAGAATGATC