Homologs in group_2118

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15910 FBDBKF_15910 79.7 Morganella morganii S1 queC 7-cyano-7-deazaguanine synthase QueC
EHELCC_18510 EHELCC_18510 79.7 Morganella morganii S2 queC 7-cyano-7-deazaguanine synthase QueC
NLDBIP_17345 NLDBIP_17345 79.7 Morganella morganii S4 queC 7-cyano-7-deazaguanine synthase QueC
LHKJJB_17315 LHKJJB_17315 79.7 Morganella morganii S3 queC 7-cyano-7-deazaguanine synthase QueC
HKOGLL_17080 HKOGLL_17080 79.7 Morganella morganii S5 queC 7-cyano-7-deazaguanine synthase QueC
F4V73_RS16400 F4V73_RS16400 78.9 Morganella psychrotolerans queC 7-cyano-7-deazaguanine synthase QueC

Distribution of the homologs in the orthogroup group_2118

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2118

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4EU60 1.59e-176 486 100 0 232 3 queC 7-cyano-7-deazaguanine synthase Proteus mirabilis (strain HI4320)
B7LMD5 1.11e-137 388 77 1 232 3 queC 7-cyano-7-deazaguanine synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q1RF91 1.91e-136 385 77 1 232 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli (strain UTI89 / UPEC)
B7N8Z8 1.91e-136 385 77 1 232 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q8FKA4 1.91e-136 385 77 1 232 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TKJ7 1.91e-136 385 77 1 232 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A8B3 1.91e-136 385 77 1 232 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli O1:K1 / APEC
B7MQG0 1.91e-136 385 77 1 232 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli O81 (strain ED1a)
B7NJ50 1.91e-136 385 77 1 232 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MDA3 1.91e-136 385 77 1 232 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli O45:K1 (strain S88 / ExPEC)
A1JNM3 2.54e-136 385 76 0 231 3 queC 7-cyano-7-deazaguanine synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q3Z4V4 4.74e-136 384 76 1 232 3 queC 7-cyano-7-deazaguanine synthase Shigella sonnei (strain Ss046)
Q83M51 4.74e-136 384 76 1 232 3 queC 7-cyano-7-deazaguanine synthase Shigella flexneri
Q325F7 4.74e-136 384 76 1 232 3 queC 7-cyano-7-deazaguanine synthase Shigella boydii serotype 4 (strain Sb227)
B2U4P9 4.74e-136 384 76 1 232 3 queC 7-cyano-7-deazaguanine synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B6HZQ1 4.74e-136 384 76 1 232 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli (strain SE11)
A7ZXA2 4.74e-136 384 76 1 232 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli O9:H4 (strain HS)
A7ZIK2 4.74e-136 384 76 1 232 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
B5Z3V1 9.98e-136 383 76 1 232 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XE52 9.98e-136 383 76 1 232 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli O157:H7
B1LJK1 1.03e-135 383 77 1 231 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli (strain SMS-3-5 / SECEC)
B7UJR7 1.16e-135 383 76 1 232 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
Q32JK2 2.59e-135 382 76 1 232 3 queC 7-cyano-7-deazaguanine synthase Shigella dysenteriae serotype 1 (strain Sd197)
P77756 2.77e-135 382 76 1 232 1 queC 7-cyano-7-deazaguanine synthase Escherichia coli (strain K12)
B1XFN2 2.77e-135 382 76 1 232 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli (strain K12 / DH10B)
C4ZTK1 2.77e-135 382 76 1 232 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli (strain K12 / MC4100 / BW2952)
B1J004 2.95e-135 382 76 1 232 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B7M3T7 2.95e-135 382 76 1 232 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli O8 (strain IAI1)
Q0T7D9 3.3e-135 382 76 1 232 3 queC 7-cyano-7-deazaguanine synthase Shigella flexneri serotype 5b (strain 8401)
A8AK09 4.95e-135 381 77 1 232 3 queC 7-cyano-7-deazaguanine synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B7L681 5.28e-135 381 76 1 232 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli (strain 55989 / EAEC)
B1JHR4 5.41e-135 381 74 0 231 3 queC 7-cyano-7-deazaguanine synthase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66DS7 5.41e-135 381 74 0 231 3 queC 7-cyano-7-deazaguanine synthase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TPD5 5.41e-135 381 74 0 231 3 queC 7-cyano-7-deazaguanine synthase Yersinia pestis (strain Pestoides F)
Q1CL58 5.41e-135 381 74 0 231 3 queC 7-cyano-7-deazaguanine synthase Yersinia pestis bv. Antiqua (strain Nepal516)
A9QZP5 5.41e-135 381 74 0 231 3 queC 7-cyano-7-deazaguanine synthase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZC72 5.41e-135 381 74 0 231 3 queC 7-cyano-7-deazaguanine synthase Yersinia pestis
B2K6W4 5.41e-135 381 74 0 231 3 queC 7-cyano-7-deazaguanine synthase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C4L5 5.41e-135 381 74 0 231 3 queC 7-cyano-7-deazaguanine synthase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FLB7 5.41e-135 381 74 0 231 3 queC 7-cyano-7-deazaguanine synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q7N0M0 1.36e-134 380 76 0 231 3 queC 7-cyano-7-deazaguanine synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6D820 3.09e-134 379 77 1 232 1 queC 7-cyano-7-deazaguanine synthase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
C0Q7Y0 6.08e-133 376 75 1 232 3 queC 7-cyano-7-deazaguanine synthase Salmonella paratyphi C (strain RKS4594)
Q57SA8 6.08e-133 376 75 1 232 3 queC 7-cyano-7-deazaguanine synthase Salmonella choleraesuis (strain SC-B67)
A4W7B5 8.27e-133 376 75 1 232 3 queC 7-cyano-7-deazaguanine synthase Enterobacter sp. (strain 638)
Q7CR22 1.05e-132 375 75 1 232 3 queC 7-cyano-7-deazaguanine synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XEU3 1.05e-132 375 75 1 232 3 queC 7-cyano-7-deazaguanine synthase Salmonella typhi
B5QU45 1.05e-132 375 75 1 232 3 queC 7-cyano-7-deazaguanine synthase Salmonella enteritidis PT4 (strain P125109)
B5FKW0 1.05e-132 375 75 1 232 3 queC 7-cyano-7-deazaguanine synthase Salmonella dublin (strain CT_02021853)
B5EXJ5 1.05e-132 375 75 1 232 3 queC 7-cyano-7-deazaguanine synthase Salmonella agona (strain SL483)
A9MWC2 1.14e-132 375 75 1 232 3 queC 7-cyano-7-deazaguanine synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
A6T5I7 1.32e-132 375 74 1 231 3 queC 7-cyano-7-deazaguanine synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B4SWU8 1.38e-132 375 75 1 232 3 queC 7-cyano-7-deazaguanine synthase Salmonella newport (strain SL254)
B5Y0T5 1.69e-132 375 74 1 231 3 queC 7-cyano-7-deazaguanine synthase Klebsiella pneumoniae (strain 342)
C6DB62 2.01e-132 375 75 1 232 3 queC 7-cyano-7-deazaguanine synthase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B5BD76 2.15e-132 375 75 1 232 3 queC 7-cyano-7-deazaguanine synthase Salmonella paratyphi A (strain AKU_12601)
Q5PFP1 2.15e-132 375 75 1 232 3 queC 7-cyano-7-deazaguanine synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4TMD3 2.7e-132 374 75 1 232 3 queC 7-cyano-7-deazaguanine synthase Salmonella schwarzengrund (strain CVM19633)
B4T9F0 4.83e-132 374 75 1 232 3 queC 7-cyano-7-deazaguanine synthase Salmonella heidelberg (strain SL476)
B5R6V6 4.83e-132 374 75 1 232 3 queC 7-cyano-7-deazaguanine synthase Salmonella gallinarum (strain 287/91 / NCTC 13346)
A8GAR6 6.65e-132 374 74 0 231 3 queC 7-cyano-7-deazaguanine synthase Serratia proteamaculans (strain 568)
A7MFJ8 8.45e-132 373 76 1 232 3 queC 7-cyano-7-deazaguanine synthase Cronobacter sakazakii (strain ATCC BAA-894)
C5BCK3 1.98e-131 372 76 2 232 3 queC 7-cyano-7-deazaguanine synthase Edwardsiella ictaluri (strain 93-146)
A9MM16 2.24e-131 372 75 1 232 3 queC 7-cyano-7-deazaguanine synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q2NV74 1.17e-127 363 72 1 231 3 queC 7-cyano-7-deazaguanine synthase Sodalis glossinidius (strain morsitans)
B2VIU4 2.13e-126 360 72 1 231 3 queC 7-cyano-7-deazaguanine synthase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
Q4K6M3 1.14e-125 358 72 2 233 3 queC2 7-cyano-7-deazaguanine synthase 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A0KJA0 3.62e-122 349 71 1 231 3 queC 7-cyano-7-deazaguanine synthase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
A4SLT2 5.44e-121 346 70 1 231 3 queC 7-cyano-7-deazaguanine synthase Aeromonas salmonicida (strain A449)
Q5E4H1 1.6e-118 340 68 1 229 3 queC 7-cyano-7-deazaguanine synthase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5FF08 4.2e-118 338 67 1 229 3 queC 7-cyano-7-deazaguanine synthase Aliivibrio fischeri (strain MJ11)
B6EH68 7.85e-118 338 68 1 229 3 queC 7-cyano-7-deazaguanine synthase Aliivibrio salmonicida (strain LFI1238)
C3LM61 2.03e-117 337 69 1 228 3 queC 7-cyano-7-deazaguanine synthase Vibrio cholerae serotype O1 (strain M66-2)
Q9KS93 2.03e-117 337 69 1 228 3 queC 7-cyano-7-deazaguanine synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F8G4 2.03e-117 337 69 1 228 3 queC 7-cyano-7-deazaguanine synthase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q6LTJ7 2.1e-117 337 71 1 222 3 queC 7-cyano-7-deazaguanine synthase Photobacterium profundum (strain SS9)
B8E544 3.46e-117 337 69 1 223 3 queC 7-cyano-7-deazaguanine synthase Shewanella baltica (strain OS223)
A6WN68 8.04e-117 336 69 1 223 3 queC 7-cyano-7-deazaguanine synthase Shewanella baltica (strain OS185)
A9L185 8.49e-117 336 69 1 223 3 queC 7-cyano-7-deazaguanine synthase Shewanella baltica (strain OS195)
A1RJY8 2.18e-116 335 70 1 220 3 queC 7-cyano-7-deazaguanine synthase Shewanella sp. (strain W3-18-1)
A4Y6J4 2.18e-116 335 70 1 220 3 queC 7-cyano-7-deazaguanine synthase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A1S6M5 1.02e-115 332 66 1 230 3 queC 7-cyano-7-deazaguanine synthase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A7MW43 3.07e-115 331 68 1 228 3 queC 7-cyano-7-deazaguanine synthase Vibrio campbellii (strain ATCC BAA-1116)
Q87P80 8.88e-115 330 67 1 228 3 queC 7-cyano-7-deazaguanine synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q1LTK2 5.47e-114 328 66 0 231 3 queC 7-cyano-7-deazaguanine synthase Baumannia cicadellinicola subsp. Homalodisca coagulata
Q8EE85 4.56e-112 323 68 1 220 3 queC 7-cyano-7-deazaguanine synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q7ML86 2.81e-111 321 65 1 228 3 queC 7-cyano-7-deazaguanine synthase Vibrio vulnificus (strain YJ016)
Q0HII5 5.79e-111 321 68 1 216 3 queC 7-cyano-7-deazaguanine synthase Shewanella sp. (strain MR-4)
Q12MM8 5.85e-111 320 66 1 228 3 queC 7-cyano-7-deazaguanine synthase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B0TSC0 9.21e-111 320 65 1 228 3 queC 7-cyano-7-deazaguanine synthase Shewanella halifaxensis (strain HAW-EB4)
A3QEN0 1.09e-110 320 65 1 228 3 queC 7-cyano-7-deazaguanine synthase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q0HVF0 5.46e-110 318 68 1 216 3 queC 7-cyano-7-deazaguanine synthase Shewanella sp. (strain MR-7)
Q8D985 5.95e-110 318 64 1 228 3 queC 7-cyano-7-deazaguanine synthase Vibrio vulnificus (strain CMCP6)
A8H532 1.6e-109 317 65 1 228 3 queC 7-cyano-7-deazaguanine synthase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
A0KX75 3.25e-109 317 68 1 216 3 queC 7-cyano-7-deazaguanine synthase Shewanella sp. (strain ANA-3)
Q082U2 5.78e-109 316 63 1 227 3 queC 7-cyano-7-deazaguanine synthase Shewanella frigidimarina (strain NCIMB 400)
A8FUY4 8.04e-108 313 64 1 228 3 queC 7-cyano-7-deazaguanine synthase Shewanella sediminis (strain HAW-EB3)
B8CM62 8.43e-108 312 65 2 217 3 queC 7-cyano-7-deazaguanine synthase Shewanella piezotolerans (strain WP3 / JCM 13877)
Q9KAP3 4.5e-96 283 62 4 221 3 queC 7-cyano-7-deazaguanine synthase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A8FCH9 4.35e-95 280 59 2 219 3 queC 7-cyano-7-deazaguanine synthase Bacillus pumilus (strain SAFR-032)
O31675 3.6e-94 278 58 2 214 1 queC 7-cyano-7-deazaguanine synthase Bacillus subtilis (strain 168)
A7Z3Y6 1.09e-93 276 58 2 217 3 queC 7-cyano-7-deazaguanine synthase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q65KI6 4.55e-93 275 58 2 217 3 queC 7-cyano-7-deazaguanine synthase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B1HPF6 4.91e-91 270 57 2 214 3 queC 7-cyano-7-deazaguanine synthase Lysinibacillus sphaericus (strain C3-41)
Q8CTH8 8.79e-91 269 57 2 217 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR20 8.79e-91 269 57 2 217 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
C5D7Y2 1.13e-90 269 59 4 219 3 queC 7-cyano-7-deazaguanine synthase Geobacillus sp. (strain WCH70)
A7GMN2 2.03e-90 268 58 2 217 3 queC 7-cyano-7-deazaguanine synthase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
B7IN35 7.47e-90 266 58 2 217 3 queC 7-cyano-7-deazaguanine synthase Bacillus cereus (strain G9842)
B9IUT0 1.22e-89 266 58 2 217 3 queC 7-cyano-7-deazaguanine synthase Bacillus cereus (strain Q1)
B7HK63 1.22e-89 266 58 2 217 3 queC 7-cyano-7-deazaguanine synthase Bacillus cereus (strain AH187)
Q81G69 1.83e-89 266 58 2 217 3 queC 7-cyano-7-deazaguanine synthase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q6HLK6 1.91e-89 266 58 2 217 3 queC 7-cyano-7-deazaguanine synthase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63E31 1.91e-89 266 58 2 217 3 queC 7-cyano-7-deazaguanine synthase Bacillus cereus (strain ZK / E33L)
C1EM49 1.91e-89 266 58 2 217 3 queC 7-cyano-7-deazaguanine synthase Bacillus cereus (strain 03BB102)
Q73BG0 1.91e-89 266 58 2 217 3 queC 7-cyano-7-deazaguanine synthase Bacillus cereus (strain ATCC 10987 / NRS 248)
A0RBG1 1.91e-89 266 58 2 217 3 queC 7-cyano-7-deazaguanine synthase Bacillus thuringiensis (strain Al Hakam)
B7JFS4 2.66e-89 265 58 2 217 3 queC 7-cyano-7-deazaguanine synthase Bacillus cereus (strain AH820)
Q81TC7 2.66e-89 265 58 2 217 3 queC 7-cyano-7-deazaguanine synthase Bacillus anthracis
C3LAL0 2.66e-89 265 58 2 217 3 queC 7-cyano-7-deazaguanine synthase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P4F6 2.66e-89 265 58 2 217 3 queC 7-cyano-7-deazaguanine synthase Bacillus anthracis (strain A0248)
Q7A1I5 5.07e-89 265 55 2 220 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus aureus (strain MW2)
A8YZY3 5.07e-89 265 55 2 220 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus aureus (strain USA300 / TCH1516)
Q6GBB8 5.07e-89 265 55 2 220 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus aureus (strain MSSA476)
Q6GIT0 5.07e-89 265 55 2 220 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus aureus (strain MRSA252)
Q7A6U7 5.07e-89 265 55 2 220 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus aureus (strain N315)
Q99VR1 5.07e-89 265 55 2 220 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QF21 5.07e-89 265 55 2 220 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus aureus (strain Newman)
Q5HHV8 5.07e-89 265 55 2 220 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus aureus (strain COL)
A5IQR6 5.07e-89 265 55 2 220 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus aureus (strain JH9)
Q2G1X6 5.07e-89 265 55 2 220 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIS8 5.07e-89 265 55 2 220 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus aureus (strain USA300)
A6TZJ0 5.07e-89 265 55 2 220 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus aureus (strain JH1)
A7WZJ4 5.07e-89 265 55 2 220 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus aureus (strain Mu3 / ATCC 700698)
A9VKR8 5.12e-89 265 56 2 219 3 queC 7-cyano-7-deazaguanine synthase Bacillus mycoides (strain KBAB4)
Q5L1C0 7.85e-89 264 57 4 222 3 queC 7-cyano-7-deazaguanine synthase Geobacillus kaustophilus (strain HTA426)
B7HH96 8.56e-89 264 57 2 217 3 queC 7-cyano-7-deazaguanine synthase Bacillus cereus (strain B4264)
Q2YSL9 9.46e-89 264 55 2 220 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus aureus (strain bovine RF122 / ET3-1)
A6LWG7 4.5e-88 262 56 2 216 3 queC 7-cyano-7-deazaguanine synthase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
A4ILN7 4.92e-88 262 58 4 222 3 queC 7-cyano-7-deazaguanine synthase Geobacillus thermodenitrificans (strain NG80-2)
Q4L4D0 9.92e-88 261 55 2 218 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus haemolyticus (strain JCSC1435)
Q5WG41 1.54e-86 258 58 4 218 3 queC 7-cyano-7-deazaguanine synthase Shouchella clausii (strain KSM-K16)
B7GLA4 9.55e-86 256 57 4 219 3 queC 7-cyano-7-deazaguanine synthase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
Q5M4S5 5.48e-85 254 57 3 217 3 queC 7-cyano-7-deazaguanine synthase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M064 5.48e-85 254 57 3 217 3 queC 7-cyano-7-deazaguanine synthase Streptococcus thermophilus (strain CNRZ 1066)
Q03L16 1.92e-84 253 57 3 217 3 queC 7-cyano-7-deazaguanine synthase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q49VQ7 3.69e-83 250 53 2 217 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
B1YFM6 4.83e-83 249 56 4 218 3 queC 7-cyano-7-deazaguanine synthase Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
C4L0V4 1.03e-80 243 54 4 215 3 queC 7-cyano-7-deazaguanine synthase Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q8DUK7 1.71e-80 243 54 5 219 3 queC 7-cyano-7-deazaguanine synthase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
A6L2J2 6.2e-80 241 53 4 216 3 queC 7-cyano-7-deazaguanine synthase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q8A7F8 1.29e-78 238 53 5 217 3 queC 7-cyano-7-deazaguanine synthase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
A9M1Y9 7.23e-78 236 53 3 222 3 queC 7-cyano-7-deazaguanine synthase Neisseria meningitidis serogroup C (strain 053442)
Q8K986 1.85e-77 236 47 1 231 3 queC 7-cyano-7-deazaguanine synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
C3KVW4 2.35e-77 235 51 2 209 3 queC 7-cyano-7-deazaguanine synthase Clostridium botulinum (strain 657 / Type Ba4)
Q97D53 4.48e-77 234 53 2 209 3 queC 7-cyano-7-deazaguanine synthase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q9JVT8 5.88e-77 234 54 4 222 3 queC 7-cyano-7-deazaguanine synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q64WB0 6.56e-77 234 51 4 217 3 queC 7-cyano-7-deazaguanine synthase Bacteroides fragilis (strain YCH46)
Q5LFI6 6.56e-77 234 51 4 217 3 queC 7-cyano-7-deazaguanine synthase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
B1IL95 1.06e-76 233 49 3 222 3 queC 7-cyano-7-deazaguanine synthase Clostridium botulinum (strain Okra / Type B1)
A7GDP2 1.79e-76 233 49 3 222 3 queC 7-cyano-7-deazaguanine synthase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
A1KSD4 2.2e-76 233 54 4 222 3 queC 7-cyano-7-deazaguanine synthase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
C1FN27 3.68e-76 232 50 2 209 3 queC 7-cyano-7-deazaguanine synthase Clostridium botulinum (strain Kyoto / Type A2)
A5I232 3.76e-76 232 50 2 209 3 queC 7-cyano-7-deazaguanine synthase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FU68 3.76e-76 232 50 2 209 3 queC 7-cyano-7-deazaguanine synthase Clostridium botulinum (strain ATCC 19397 / Type A)
Q9K0Q9 4.2e-76 232 53 4 222 3 queC 7-cyano-7-deazaguanine synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A0Q1F7 7.99e-75 228 48 3 221 3 queC 7-cyano-7-deazaguanine synthase Clostridium novyi (strain NT)
B1L1S2 9.83e-75 228 49 2 209 3 queC 7-cyano-7-deazaguanine synthase Clostridium botulinum (strain Loch Maree / Type A3)
B4RQ61 4.47e-72 221 51 4 222 3 queC 7-cyano-7-deazaguanine synthase Neisseria gonorrhoeae (strain NCCP11945)
Q5FA99 6.06e-72 221 51 4 223 3 queC 7-cyano-7-deazaguanine synthase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A6VQW6 3.84e-71 219 50 5 222 3 queC 7-cyano-7-deazaguanine synthase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q4QLA8 2.43e-69 215 48 4 219 3 queC 7-cyano-7-deazaguanine synthase Haemophilus influenzae (strain 86-028NP)
A5UCR9 1.13e-68 213 48 4 219 3 queC 7-cyano-7-deazaguanine synthase Haemophilus influenzae (strain PittEE)
Q9CP69 1.48e-68 213 48 3 220 3 queC 7-cyano-7-deazaguanine synthase Pasteurella multocida (strain Pm70)
Q65RE8 2.25e-68 212 49 5 219 3 queC 7-cyano-7-deazaguanine synthase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q7VNH6 3.39e-67 209 49 5 220 3 queC 7-cyano-7-deazaguanine synthase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P44124 3.72e-67 209 48 5 220 3 queC 7-cyano-7-deazaguanine synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A3N1A3 9.05e-67 208 48 5 220 3 queC 7-cyano-7-deazaguanine synthase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B3H1X8 1.21e-66 208 48 5 220 3 queC 7-cyano-7-deazaguanine synthase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B0BQ32 2.14e-66 207 48 5 220 3 queC 7-cyano-7-deazaguanine synthase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B8F6L5 2.88e-66 207 46 4 221 3 queC 7-cyano-7-deazaguanine synthase Glaesserella parasuis serovar 5 (strain SH0165)
Q0A550 5.44e-65 204 48 5 228 3 queC 7-cyano-7-deazaguanine synthase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A6LIS9 1.54e-64 202 50 6 217 3 queC 7-cyano-7-deazaguanine synthase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
A9AC62 7.2e-62 196 45 6 233 3 queC 7-cyano-7-deazaguanine synthase Burkholderia multivorans (strain ATCC 17616 / 249)
Q0BAU3 1.85e-61 195 45 6 233 3 queC 7-cyano-7-deazaguanine synthase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YPW9 1.85e-61 195 45 6 233 3 queC 7-cyano-7-deazaguanine synthase Burkholderia ambifaria (strain MC40-6)
A4JIU1 2.3e-61 195 44 6 233 3 queC 7-cyano-7-deazaguanine synthase Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q146Z6 2.46e-61 195 44 6 236 3 queC 7-cyano-7-deazaguanine synthase Paraburkholderia xenovorans (strain LB400)
Q220R7 2.49e-61 195 45 6 242 3 queC 7-cyano-7-deazaguanine synthase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
B2T1L3 3.41e-61 195 43 6 236 3 queC 7-cyano-7-deazaguanine synthase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q39BV2 4.01e-61 194 43 6 233 3 queC 7-cyano-7-deazaguanine synthase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B4E7W5 4.98e-61 194 43 6 236 3 queC 7-cyano-7-deazaguanine synthase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q1BSK1 5.32e-61 194 43 6 236 3 queC 7-cyano-7-deazaguanine synthase Burkholderia orbicola (strain AU 1054)
B1K0I8 5.32e-61 194 43 6 236 3 queC 7-cyano-7-deazaguanine synthase Burkholderia orbicola (strain MC0-3)
A0KBJ0 5.32e-61 194 43 6 236 3 queC 7-cyano-7-deazaguanine synthase Burkholderia cenocepacia (strain HI2424)
Q63YL0 7.37e-61 194 44 8 235 3 queC 7-cyano-7-deazaguanine synthase Burkholderia pseudomallei (strain K96243)
A3N4E3 7.37e-61 194 44 8 235 3 queC 7-cyano-7-deazaguanine synthase Burkholderia pseudomallei (strain 668)
Q3JXD3 7.37e-61 194 44 8 235 3 queC 7-cyano-7-deazaguanine synthase Burkholderia pseudomallei (strain 1710b)
A3NQ33 7.37e-61 194 44 8 235 3 queC 7-cyano-7-deazaguanine synthase Burkholderia pseudomallei (strain 1106a)
A1V788 7.37e-61 194 44 8 235 3 queC 7-cyano-7-deazaguanine synthase Burkholderia mallei (strain SAVP1)
Q62MS6 7.37e-61 194 44 8 235 3 queC 7-cyano-7-deazaguanine synthase Burkholderia mallei (strain ATCC 23344)
A2S8H7 7.37e-61 194 44 8 235 3 queC 7-cyano-7-deazaguanine synthase Burkholderia mallei (strain NCTC 10229)
A3MNQ3 7.37e-61 194 44 8 235 3 queC 7-cyano-7-deazaguanine synthase Burkholderia mallei (strain NCTC 10247)
Q2T2A4 7.78e-61 194 44 8 235 3 queC 7-cyano-7-deazaguanine synthase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A1WY18 1.4e-60 193 43 4 237 3 queC 7-cyano-7-deazaguanine synthase Halorhodospira halophila (strain DSM 244 / SL1)
A6T2X9 1.59e-60 192 45 6 224 3 queC 7-cyano-7-deazaguanine synthase Janthinobacterium sp. (strain Marseille)
A5EJ03 4.42e-60 192 45 7 229 3 queC 7-cyano-7-deazaguanine synthase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A1WSR5 1.09e-59 191 45 5 226 3 queC 7-cyano-7-deazaguanine synthase Verminephrobacter eiseniae (strain EF01-2)
Q5NNR3 1.52e-59 191 43 6 233 3 queC 7-cyano-7-deazaguanine synthase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q07ML3 3.01e-59 189 45 6 231 3 queC 7-cyano-7-deazaguanine synthase Rhodopseudomonas palustris (strain BisA53)
A4YUN8 3.11e-59 189 45 7 229 3 queC 7-cyano-7-deazaguanine synthase Bradyrhizobium sp. (strain ORS 278)
B2JJV1 8.23e-59 189 41 5 238 3 queC 7-cyano-7-deazaguanine synthase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q1QM87 1.45e-58 188 43 6 234 3 queC 7-cyano-7-deazaguanine synthase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A1TIG3 1.68e-58 187 43 5 226 3 queC 7-cyano-7-deazaguanine synthase Paracidovorax citrulli (strain AAC00-1)
Q2IWJ9 2.01e-58 187 45 6 228 3 queC1 7-cyano-7-deazaguanine synthase 1 Rhodopseudomonas palustris (strain HaA2)
A4G964 3.27e-58 187 44 5 224 3 queC 7-cyano-7-deazaguanine synthase Herminiimonas arsenicoxydans
Q3SSM7 8.79e-58 186 43 6 234 3 queC 7-cyano-7-deazaguanine synthase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
B8H3X3 1.99e-57 185 43 5 227 3 queC 7-cyano-7-deazaguanine synthase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A3P2 1.99e-57 185 43 5 227 3 queC 7-cyano-7-deazaguanine synthase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
A8IMX7 2.34e-57 185 43 6 228 3 queC 7-cyano-7-deazaguanine synthase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q213Y7 2.35e-57 185 43 5 231 3 queC 7-cyano-7-deazaguanine synthase Rhodopseudomonas palustris (strain BisB18)
Q89LP8 2.64e-57 184 43 5 230 3 queC 7-cyano-7-deazaguanine synthase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q7M8H4 3.77e-57 184 44 2 216 3 queC 7-cyano-7-deazaguanine synthase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
A1VB03 5e-57 184 45 6 229 3 queC 7-cyano-7-deazaguanine synthase Nitratidesulfovibrio vulgaris (strain DP4)
Q728E4 5e-57 184 45 6 229 3 queC 7-cyano-7-deazaguanine synthase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
B3QKK5 1.06e-56 183 42 5 231 3 queC 7-cyano-7-deazaguanine synthase Rhodopseudomonas palustris (strain TIE-1)
Q6N608 1.17e-56 183 42 5 231 3 queC 7-cyano-7-deazaguanine synthase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A1VJX7 1.2e-56 183 47 5 230 3 queC 7-cyano-7-deazaguanine synthase Polaromonas naphthalenivorans (strain CJ2)
B2UTI7 1.59e-56 182 39 2 220 3 queC 7-cyano-7-deazaguanine synthase Helicobacter pylori (strain Shi470)
Q136L0 2.38e-56 182 43 5 223 3 queC 7-cyano-7-deazaguanine synthase Rhodopseudomonas palustris (strain BisB5)
Q1GPS4 2.67e-56 182 44 6 225 3 queC2 7-cyano-7-deazaguanine synthase 2 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q17XR6 2.86e-56 181 40 2 212 3 queC 7-cyano-7-deazaguanine synthase Helicobacter acinonychis (strain Sheeba)
B6JLM6 4.11e-56 181 40 2 212 3 queC 7-cyano-7-deazaguanine synthase Helicobacter pylori (strain P12)
Q12FK2 7.84e-56 181 47 6 228 3 queC 7-cyano-7-deazaguanine synthase Polaromonas sp. (strain JS666 / ATCC BAA-500)
B5Z711 8.27e-56 180 39 2 220 3 queC 7-cyano-7-deazaguanine synthase Helicobacter pylori (strain G27)
Q1CTN3 9.08e-56 180 40 2 212 3 queC 7-cyano-7-deazaguanine synthase Helicobacter pylori (strain HPAG1)
A1W9G0 2.59e-55 179 41 6 235 3 queC 7-cyano-7-deazaguanine synthase Acidovorax sp. (strain JS42)
B9MBJ3 2.59e-55 179 41 6 235 3 queC 7-cyano-7-deazaguanine synthase Acidovorax ebreus (strain TPSY)
O25356 9.01e-55 177 38 2 223 3 queC 7-cyano-7-deazaguanine synthase Helicobacter pylori (strain ATCC 700392 / 26695)
Q7NCE2 1.03e-54 178 46 6 219 3 queC 7-cyano-7-deazaguanine synthase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q0BQ87 1.11e-54 178 42 6 240 3 queC 7-cyano-7-deazaguanine synthase Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q7NSB9 2.45e-54 177 43 5 212 3 queC 7-cyano-7-deazaguanine synthase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
B0SX50 2.93e-54 177 44 6 225 3 queC 7-cyano-7-deazaguanine synthase Caulobacter sp. (strain K31)
A2SCE3 3.53e-54 176 42 5 231 3 queC 7-cyano-7-deazaguanine synthase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
C1D6L0 3.83e-54 176 42 4 210 3 queC 7-cyano-7-deazaguanine synthase Laribacter hongkongensis (strain HLHK9)
B1Y8J4 4.53e-54 176 42 6 237 3 queC 7-cyano-7-deazaguanine synthase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q9ZLJ7 5.53e-54 176 38 2 216 3 queC 7-cyano-7-deazaguanine synthase Helicobacter pylori (strain J99 / ATCC 700824)
Q1MQ73 5.7e-54 176 40 5 237 3 queC 7-cyano-7-deazaguanine synthase Lawsonia intracellularis (strain PHE/MN1-00)
A7HXX1 1.97e-53 174 42 6 233 3 queC 7-cyano-7-deazaguanine synthase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q0ARS7 2.48e-53 174 41 4 227 3 queC 7-cyano-7-deazaguanine synthase Maricaulis maris (strain MCS10)
A9W222 3.62e-53 174 43 4 232 3 queC 7-cyano-7-deazaguanine synthase Methylorubrum extorquens (strain PA1)
Q5FQR2 1.09e-51 170 41 5 232 3 queC 7-cyano-7-deazaguanine synthase Gluconobacter oxydans (strain 621H)
A9HRF6 1.1e-51 171 40 4 234 3 queC 7-cyano-7-deazaguanine synthase Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
B7KR63 1.41e-51 170 43 4 232 3 queC 7-cyano-7-deazaguanine synthase Methylorubrum extorquens (strain CM4 / NCIMB 13688)
Q98AM3 1.45e-51 170 41 6 238 3 queC2 7-cyano-7-deazaguanine synthase 2 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q7WCA8 3.8e-51 169 44 5 228 3 queC 7-cyano-7-deazaguanine synthase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7W0D1 4.06e-51 169 44 5 228 3 queC 7-cyano-7-deazaguanine synthase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WQB2 4.06e-51 169 44 5 228 3 queC 7-cyano-7-deazaguanine synthase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q8ETE9 3.57e-50 166 41 4 213 3 queC 7-cyano-7-deazaguanine synthase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q2KZT1 9.76e-50 165 41 5 233 3 queC 7-cyano-7-deazaguanine synthase Bordetella avium (strain 197N)
Q0C4T2 3.49e-49 164 39 6 240 3 queC 7-cyano-7-deazaguanine synthase Hyphomonas neptunium (strain ATCC 15444)
Q8F964 6.39e-49 163 41 6 216 3 queC 7-cyano-7-deazaguanine synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72VK9 6.39e-49 163 41 6 216 3 queC 7-cyano-7-deazaguanine synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
A3DK21 1.8e-48 161 41 5 217 3 queC 7-cyano-7-deazaguanine synthase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q24VU8 6.98e-48 160 40 5 216 3 queC2 7-cyano-7-deazaguanine synthase 2 Desulfitobacterium hafniense (strain Y51)
B8G1I4 9.15e-48 160 40 5 216 3 queC 7-cyano-7-deazaguanine synthase Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q5ZRJ5 2.21e-47 159 41 7 219 3 queC 7-cyano-7-deazaguanine synthase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q5WSS7 2.55e-47 159 41 7 219 3 queC 7-cyano-7-deazaguanine synthase Legionella pneumophila (strain Lens)
Q055M9 1.6e-46 157 40 6 216 3 queC 7-cyano-7-deazaguanine synthase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04PP1 1.6e-46 157 40 6 216 3 queC 7-cyano-7-deazaguanine synthase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q5X101 3.03e-46 156 40 7 219 3 queC 7-cyano-7-deazaguanine synthase Legionella pneumophila (strain Paris)
A5II59 9.95e-46 154 40 7 219 3 queC 7-cyano-7-deazaguanine synthase Legionella pneumophila (strain Corby)
Q0VRI8 1.8e-45 154 41 6 221 3 queC 7-cyano-7-deazaguanine synthase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A5N597 1.88e-45 154 41 5 213 3 queC 7-cyano-7-deazaguanine synthase Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DYU5 1.88e-45 154 41 5 213 3 queC 7-cyano-7-deazaguanine synthase Clostridium kluyveri (strain NBRC 12016)
Q478G3 4.81e-44 150 40 6 217 3 queC 7-cyano-7-deazaguanine synthase Dechloromonas aromatica (strain RCB)
A7HHA2 5.83e-44 150 41 5 217 3 queC 7-cyano-7-deazaguanine synthase Anaeromyxobacter sp. (strain Fw109-5)
Q21HP4 1.8e-43 149 38 7 217 3 queC 7-cyano-7-deazaguanine synthase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B2FRM5 1.91e-43 149 41 7 217 3 queC 7-cyano-7-deazaguanine synthase Stenotrophomonas maltophilia (strain K279a)
A9NBS5 7.19e-43 147 37 6 217 3 queC 7-cyano-7-deazaguanine synthase Coxiella burnetii (strain RSA 331 / Henzerling II)
Q2IG55 2e-42 146 40 5 217 3 queC 7-cyano-7-deazaguanine synthase Anaeromyxobacter dehalogenans (strain 2CP-C)
Q480C9 3.52e-42 145 40 5 206 3 queC1 7-cyano-7-deazaguanine synthase 1 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q15RL9 4.56e-42 145 38 8 227 3 queC 7-cyano-7-deazaguanine synthase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q83A28 5.52e-42 145 36 6 217 3 queC 7-cyano-7-deazaguanine synthase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
B4ST23 5.65e-42 145 40 7 217 3 queC 7-cyano-7-deazaguanine synthase Stenotrophomonas maltophilia (strain R551-3)
A9KDD3 5.7e-42 145 36 6 217 3 queC 7-cyano-7-deazaguanine synthase Coxiella burnetii (strain Dugway 5J108-111)
Q979P0 8.89e-42 145 39 7 215 3 queC 7-cyano-7-deazaguanine synthase Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
A6V9Z6 1.17e-41 144 38 6 216 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas aeruginosa (strain PA7)
Q6F9A3 2.71e-41 143 39 8 215 3 queC 7-cyano-7-deazaguanine synthase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q31H76 4.11e-41 143 38 6 217 3 queC 7-cyano-7-deazaguanine synthase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q9I4Z2 6.65e-41 142 38 6 216 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02ID8 6.65e-41 142 38 6 216 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UXV6 6.65e-41 142 38 6 216 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas aeruginosa (strain LESB58)
A5CWP9 7.43e-41 142 37 6 215 3 queC 7-cyano-7-deazaguanine synthase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q609K0 1.21e-40 141 38 6 217 3 queC 7-cyano-7-deazaguanine synthase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A0L4R8 1.29e-40 141 39 7 221 3 queC 7-cyano-7-deazaguanine synthase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A5WGB5 1.66e-40 142 36 7 225 3 queC 7-cyano-7-deazaguanine synthase Psychrobacter sp. (strain PRwf-1)
A1AWK9 2.09e-40 141 37 6 215 3 queC 7-cyano-7-deazaguanine synthase Ruthia magnifica subsp. Calyptogena magnifica
A4VN94 2.56e-40 140 37 6 216 3 queC 7-cyano-7-deazaguanine synthase Stutzerimonas stutzeri (strain A1501)
C4XPJ3 2.72e-40 141 39 7 220 3 queC 7-cyano-7-deazaguanine synthase Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q7UFU6 3.17e-40 141 38 7 222 3 queC 7-cyano-7-deazaguanine synthase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q9PCC3 3.32e-40 140 39 7 217 3 queC 7-cyano-7-deazaguanine synthase Xylella fastidiosa (strain 9a5c)
Q48FD4 3.92e-40 140 37 6 216 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A8GPK3 4.81e-40 140 36 6 234 3 queC 7-cyano-7-deazaguanine synthase Rickettsia akari (strain Hartford)
Q3JER4 4.82e-40 140 37 6 215 3 queC 7-cyano-7-deazaguanine synthase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q9HJL6 6.4e-40 140 38 7 215 3 queC 7-cyano-7-deazaguanine synthase Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
A1ANI8 1.07e-39 139 40 7 217 3 queC 7-cyano-7-deazaguanine synthase Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q4ZWK2 1.14e-39 139 37 6 216 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas syringae pv. syringae (strain B728a)
A6VX48 1.36e-39 139 39 7 208 3 queC 7-cyano-7-deazaguanine synthase Marinomonas sp. (strain MWYL1)
A4XRT0 1.72e-39 139 36 6 216 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas mendocina (strain ymp)
Q87Y44 1.91e-39 138 37 6 216 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B0U2I4 1.92e-39 139 38 7 217 3 queC 7-cyano-7-deazaguanine synthase Xylella fastidiosa (strain M12)
A0LJR5 2.23e-39 139 39 8 220 3 queC 7-cyano-7-deazaguanine synthase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
B3PC22 2.77e-39 138 37 6 217 3 queC 7-cyano-7-deazaguanine synthase Cellvibrio japonicus (strain Ueda107)
Q2J7K8 3.39e-39 138 39 6 217 3 queC 7-cyano-7-deazaguanine synthase Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q87CW1 3.54e-39 138 38 7 217 3 queC 7-cyano-7-deazaguanine synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I4Y4 3.54e-39 138 38 7 217 3 queC 7-cyano-7-deazaguanine synthase Xylella fastidiosa (strain M23)
Q74FW9 4.09e-39 138 40 8 222 3 queC 7-cyano-7-deazaguanine synthase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q39R35 4.36e-39 138 39 7 217 3 queC 7-cyano-7-deazaguanine synthase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q4UMZ0 4.62e-39 137 37 6 212 3 queC 7-cyano-7-deazaguanine synthase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q5P4Z2 6.96e-39 137 37 6 217 3 queC 7-cyano-7-deazaguanine synthase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
B5EDQ7 8.14e-39 137 37 7 216 3 queC 7-cyano-7-deazaguanine synthase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
A5G8S2 8.18e-39 137 37 7 217 3 queC 7-cyano-7-deazaguanine synthase Geotalea uraniireducens (strain Rf4)
A7I7A4 8.29e-39 136 40 5 205 3 queC 7-cyano-7-deazaguanine synthase Methanoregula boonei (strain DSM 21154 / JCM 14090 / 6A8)
C6E7E7 8.96e-39 137 37 7 216 3 queC 7-cyano-7-deazaguanine synthase Geobacter sp. (strain M21)
A1STX3 2.05e-38 135 40 7 208 3 queC 7-cyano-7-deazaguanine synthase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A7GXH1 2.38e-38 135 37 6 216 3 queC 7-cyano-7-deazaguanine synthase Campylobacter curvus (strain 525.92)
Q2LVL3 2.41e-38 135 37 7 224 3 queC 7-cyano-7-deazaguanine synthase Syntrophus aciditrophicus (strain SB)
Q1RJ87 2.52e-38 135 36 7 214 3 queC 7-cyano-7-deazaguanine synthase Rickettsia bellii (strain RML369-C)
A8GVR7 2.52e-38 135 36 7 214 3 queC 7-cyano-7-deazaguanine synthase Rickettsia bellii (strain OSU 85-389)
Q1I6F8 3.61e-38 135 36 6 217 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas entomophila (strain L48)
A1K2H5 3.81e-38 135 37 6 221 3 queC 7-cyano-7-deazaguanine synthase Azoarcus sp. (strain BH72)
B8FMW6 4.4e-38 135 36 6 222 3 queC 7-cyano-7-deazaguanine synthase Desulfatibacillum aliphaticivorans
Q68W43 5.4e-38 135 35 7 234 3 queC 7-cyano-7-deazaguanine synthase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
C3JYR8 5.91e-38 134 35 6 217 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas fluorescens (strain SBW25)
Q1QCP3 5.98e-38 135 35 8 226 3 queC 7-cyano-7-deazaguanine synthase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FTN4 7.03e-38 135 35 8 226 3 queC 7-cyano-7-deazaguanine synthase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q5QUZ6 9.08e-38 134 39 5 206 3 queC 7-cyano-7-deazaguanine synthase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q6KZF9 9.1e-38 134 37 7 216 3 queC 7-cyano-7-deazaguanine synthase Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
B0KTI3 1.38e-37 134 36 6 217 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas putida (strain GB-1)
Q3IKE8 2.08e-37 133 37 6 207 3 queC 7-cyano-7-deazaguanine synthase Pseudoalteromonas translucida (strain TAC 125)
Q2S7U9 2.18e-37 133 35 6 223 3 queC 7-cyano-7-deazaguanine synthase Hahella chejuensis (strain KCTC 2396)
Q4K7E8 2.22e-37 133 36 6 216 3 queC1 7-cyano-7-deazaguanine synthase 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q8Y1F2 2.52e-37 133 36 7 217 3 queC 7-cyano-7-deazaguanine synthase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q8PHW1 2.69e-37 133 41 7 217 3 queC 7-cyano-7-deazaguanine synthase Xanthomonas axonopodis pv. citri (strain 306)
Q1CYI2 2.96e-37 133 37 7 220 3 queC 7-cyano-7-deazaguanine synthase Myxococcus xanthus (strain DK1622)
A6Q342 3.23e-37 132 36 6 213 3 queC 7-cyano-7-deazaguanine synthase Nitratiruptor sp. (strain SB155-2)
Q1GYT5 3.24e-37 133 37 7 218 3 queC 7-cyano-7-deazaguanine synthase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A7ZCA8 3.86e-37 132 35 5 215 3 queC 7-cyano-7-deazaguanine synthase Campylobacter concisus (strain 13826)
B9M0M7 4.48e-37 132 37 8 221 3 queC 7-cyano-7-deazaguanine synthase Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
B1JD61 6.29e-37 132 35 6 217 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas putida (strain W619)
A8EZR4 6.38e-37 132 34 8 234 3 queC 7-cyano-7-deazaguanine synthase Rickettsia canadensis (strain McKiel)
Q8P6F6 7.31e-37 132 41 7 217 3 queC 7-cyano-7-deazaguanine synthase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RPZ6 7.31e-37 132 41 7 217 3 queC 7-cyano-7-deazaguanine synthase Xanthomonas campestris pv. campestris (strain B100)
Q4UXK8 7.31e-37 132 41 7 217 3 queC 7-cyano-7-deazaguanine synthase Xanthomonas campestris pv. campestris (strain 8004)
A8F2I5 8.04e-37 132 35 7 233 3 queC 7-cyano-7-deazaguanine synthase Rickettsia massiliae (strain Mtu5)
B4RTX3 8.87e-37 131 37 6 207 3 queC 7-cyano-7-deazaguanine synthase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
B9L986 1.47e-36 131 36 5 215 3 queC 7-cyano-7-deazaguanine synthase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Q9WWW8 1.52e-36 131 35 6 217 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas putida
Q88NI3 1.52e-36 131 35 6 217 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q2W000 1.93e-36 130 36 6 218 3 queC 7-cyano-7-deazaguanine synthase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
A5VZV6 2.16e-36 130 36 6 216 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B2U7H6 4.11e-36 130 35 6 217 3 queC 7-cyano-7-deazaguanine synthase Ralstonia pickettii (strain 12J)
A8GTC6 4.19e-36 130 34 7 233 3 queC 7-cyano-7-deazaguanine synthase Rickettsia rickettsii (strain Sheila Smith)
B0BUW5 4.19e-36 130 34 7 233 3 queC 7-cyano-7-deazaguanine synthase Rickettsia rickettsii (strain Iowa)
B0C253 4.19e-36 130 37 7 216 3 queC 7-cyano-7-deazaguanine synthase Acaryochloris marina (strain MBIC 11017)
A6Q9Q9 4.89e-36 129 36 5 214 3 queC 7-cyano-7-deazaguanine synthase Sulfurovum sp. (strain NBC37-1)
Q0K7W8 5.01e-36 130 35 7 217 3 queC 7-cyano-7-deazaguanine synthase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
C3PLH1 5.79e-36 129 34 7 233 3 queC 7-cyano-7-deazaguanine synthase Rickettsia africae (strain ESF-5)
B0SK77 6.23e-36 130 35 6 228 3 queC 7-cyano-7-deazaguanine synthase Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0S9S9 6.23e-36 130 35 6 228 3 queC 7-cyano-7-deazaguanine synthase Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
Q0AJ94 6.66e-36 129 36 8 231 3 queC 7-cyano-7-deazaguanine synthase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
B7K7J4 6.86e-36 129 37 6 214 3 queC 7-cyano-7-deazaguanine synthase Gloeothece citriformis (strain PCC 7424)
Q3BQG4 7.92e-36 129 40 7 217 3 queC 7-cyano-7-deazaguanine synthase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
A6WGA4 7.93e-36 129 38 6 221 3 queC 7-cyano-7-deazaguanine synthase Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
Q92GQ2 8.51e-36 129 34 7 233 3 queC 7-cyano-7-deazaguanine synthase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
C4K2L7 8.89e-36 129 34 7 233 3 queC 7-cyano-7-deazaguanine synthase Rickettsia peacockii (strain Rustic)
Q3K7W9 1.17e-35 129 35 5 216 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas fluorescens (strain Pf0-1)
B2IUR7 1.87e-35 128 35 5 212 3 queC 7-cyano-7-deazaguanine synthase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
Q2RSY8 2.12e-35 128 36 7 219 3 queC 7-cyano-7-deazaguanine synthase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q2Y5H4 2.23e-35 128 35 6 218 3 queC 7-cyano-7-deazaguanine synthase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q3A090 2.23e-35 128 37 7 217 3 queC 7-cyano-7-deazaguanine synthase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q5H288 2.75e-35 127 40 7 217 3 queC 7-cyano-7-deazaguanine synthase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2STI7 2.75e-35 127 40 7 217 3 queC 7-cyano-7-deazaguanine synthase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P553 2.75e-35 127 40 7 217 3 queC 7-cyano-7-deazaguanine synthase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A7I1D0 3.48e-35 127 35 5 214 3 queC 7-cyano-7-deazaguanine synthase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
A4SVH9 4.38e-35 128 34 6 217 3 queC 7-cyano-7-deazaguanine synthase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A5V652 5.14e-35 127 36 6 216 3 queC 7-cyano-7-deazaguanine synthase Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
A5ULR3 5.3e-35 127 34 7 218 3 queC 7-cyano-7-deazaguanine synthase Methanobrevibacter smithii (strain ATCC 35061 / DSM 861 / OCM 144 / PS)
A1TWU4 5.43e-35 127 39 7 203 3 queC 7-cyano-7-deazaguanine synthase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q474K5 6.82e-35 127 35 7 217 3 queC 7-cyano-7-deazaguanine synthase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q9ZCM9 8.58e-35 126 34 7 234 3 queC 7-cyano-7-deazaguanine synthase Rickettsia prowazekii (strain Madrid E)
A2BTS3 1.27e-34 126 34 7 226 3 queC 7-cyano-7-deazaguanine synthase Prochlorococcus marinus (strain AS9601)
A4XFR8 1.3e-34 126 36 4 205 3 queC 7-cyano-7-deazaguanine synthase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q47ZY2 1.75e-34 125 38 6 208 3 queC2 7-cyano-7-deazaguanine synthase 2 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q2N612 1.95e-34 126 36 7 217 3 queC 7-cyano-7-deazaguanine synthase Erythrobacter litoralis (strain HTCC2594)
A3PFI0 2.1e-34 125 33 7 226 3 queC 7-cyano-7-deazaguanine synthase Prochlorococcus marinus (strain MIT 9301)
B3R5T4 2.61e-34 125 34 7 217 3 queC 7-cyano-7-deazaguanine synthase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q5HXE2 3.06e-34 125 34 4 214 3 queC 7-cyano-7-deazaguanine synthase Campylobacter jejuni (strain RM1221)
P0C634 3.06e-34 125 34 4 214 3 queC 7-cyano-7-deazaguanine synthase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
B8HQ99 4.65e-34 125 37 5 216 3 queC 7-cyano-7-deazaguanine synthase Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Q1LJY1 5.02e-34 124 35 7 217 3 queC 7-cyano-7-deazaguanine synthase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
C1DRE9 7.6e-34 124 36 6 216 3 queC 7-cyano-7-deazaguanine synthase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A8FJH9 8.55e-34 124 34 4 214 3 queC 7-cyano-7-deazaguanine synthase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q317V0 1.09e-33 124 35 7 214 3 queC 7-cyano-7-deazaguanine synthase Prochlorococcus marinus (strain MIT 9312)
A7H1A8 1.17e-33 123 35 6 215 3 queC 7-cyano-7-deazaguanine synthase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A1VX95 1.27e-33 123 34 4 214 3 queC 7-cyano-7-deazaguanine synthase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
A8G7J6 2.69e-33 122 33 7 225 3 queC 7-cyano-7-deazaguanine synthase Prochlorococcus marinus (strain MIT 9215)
Q82XN5 3.11e-33 122 36 7 217 3 queC 7-cyano-7-deazaguanine synthase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
B9MMB0 4.94e-33 122 36 5 206 3 queC 7-cyano-7-deazaguanine synthase Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q114E1 5.23e-33 122 33 5 212 3 queC 7-cyano-7-deazaguanine synthase Trichodesmium erythraeum (strain IMS101)
Q7V9H8 9.01e-33 121 35 6 215 3 queC 7-cyano-7-deazaguanine synthase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q1QVW9 1.23e-32 122 37 7 208 3 queC 7-cyano-7-deazaguanine synthase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q3AGF3 1.26e-32 121 33 5 216 3 queC 7-cyano-7-deazaguanine synthase Synechococcus sp. (strain CC9605)
A6URL5 1.27e-32 121 32 8 223 3 queC 7-cyano-7-deazaguanine synthase Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
Q3MAK6 1.31e-32 121 38 6 213 3 queC 7-cyano-7-deazaguanine synthase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q7UZH5 1.71e-32 120 33 7 226 3 queC 7-cyano-7-deazaguanine synthase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
Q2G3K1 1.86e-32 120 34 6 215 3 queC 7-cyano-7-deazaguanine synthase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q8YM45 2.32e-32 120 37 6 213 3 queC 7-cyano-7-deazaguanine synthase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q3SGT8 2.43e-32 120 36 6 214 3 queC 7-cyano-7-deazaguanine synthase Thiobacillus denitrificans (strain ATCC 25259)
Q7U3K1 2.53e-32 120 33 5 216 3 queC 7-cyano-7-deazaguanine synthase Parasynechococcus marenigrum (strain WH8102)
Q1IHK6 3.94e-32 120 36 6 216 3 queC 7-cyano-7-deazaguanine synthase Koribacter versatilis (strain Ellin345)
Q55468 4.9e-32 119 36 6 215 3 queC 7-cyano-7-deazaguanine synthase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8DI59 5.9e-32 119 36 6 214 3 queC 7-cyano-7-deazaguanine synthase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
A5GWT8 8.15e-32 119 36 6 214 3 queC 7-cyano-7-deazaguanine synthase Synechococcus sp. (strain RCC307)
O67003 1.37e-31 118 33 7 224 3 queC 7-cyano-7-deazaguanine synthase Aquifex aeolicus (strain VF5)
B2V5L9 2.3e-31 117 32 7 219 3 queC 7-cyano-7-deazaguanine synthase Sulfurihydrogenibium sp. (strain YO3AOP1)
C1F844 2.62e-31 117 35 7 217 3 queC 7-cyano-7-deazaguanine synthase Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
Q6M0P3 2.74e-31 117 31 7 220 3 queC 7-cyano-7-deazaguanine synthase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
A0RM81 2.92e-31 117 34 6 221 3 queC 7-cyano-7-deazaguanine synthase Campylobacter fetus subsp. fetus (strain 82-40)
A4FZY3 3.11e-31 117 33 9 221 3 queC 7-cyano-7-deazaguanine synthase Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
A8EWF5 3.48e-31 117 34 6 218 3 queC 7-cyano-7-deazaguanine synthase Aliarcobacter butzleri (strain RM4018)
A6VIL3 3.61e-31 117 32 9 221 3 queC 7-cyano-7-deazaguanine synthase Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
A2C5G1 6.89e-31 116 32 6 214 3 queC 7-cyano-7-deazaguanine synthase Prochlorococcus marinus (strain NATL1A)
A3CXN3 8.26e-31 116 34 6 224 3 queC 7-cyano-7-deazaguanine synthase Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Q1GTF3 1.03e-30 116 35 6 216 3 queC1 7-cyano-7-deazaguanine synthase 1 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
A9A873 1.06e-30 116 31 9 222 3 queC 7-cyano-7-deazaguanine synthase Methanococcus maripaludis (strain C6 / ATCC BAA-1332)
Q5N5K7 2.42e-30 115 33 7 237 3 queC 7-cyano-7-deazaguanine synthase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31NK6 2.42e-30 115 33 7 237 3 queC 7-cyano-7-deazaguanine synthase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q46I95 2.75e-30 115 31 6 213 3 queC 7-cyano-7-deazaguanine synthase Prochlorococcus marinus (strain NATL2A)
A2BZ78 8.22e-30 114 33 7 215 3 queC 7-cyano-7-deazaguanine synthase Prochlorococcus marinus (strain MIT 9515)
B8GJL3 1.23e-29 113 32 5 212 3 queC 7-cyano-7-deazaguanine synthase Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
O29807 1.35e-29 113 37 8 209 3 queC 7-cyano-7-deazaguanine synthase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q2FS65 4.23e-29 111 34 5 208 3 queC 7-cyano-7-deazaguanine synthase Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
B3ENV8 4.35e-29 112 34 6 218 3 queC 7-cyano-7-deazaguanine synthase Chlorobium phaeobacteroides (strain BS1)
Q3AUG1 4.49e-29 112 33 5 214 3 queC 7-cyano-7-deazaguanine synthase Synechococcus sp. (strain CC9902)
O57836 9.03e-29 111 32 8 238 3 queC 7-cyano-7-deazaguanine synthase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
B0JIA6 1.07e-28 110 31 9 244 3 queC 7-cyano-7-deazaguanine synthase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
C0QST3 2.1e-28 110 32 6 209 3 queC 7-cyano-7-deazaguanine synthase Persephonella marina (strain DSM 14350 / EX-H1)
Q9V2I3 2.99e-28 110 31 9 239 3 queC 7-cyano-7-deazaguanine synthase Pyrococcus abyssi (strain GE5 / Orsay)
Q6ARX9 4.15e-28 109 34 5 212 3 queC 7-cyano-7-deazaguanine synthase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
B3QPB3 5.7e-28 108 33 5 212 3 queC 7-cyano-7-deazaguanine synthase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q8KF00 7.27e-28 108 33 5 212 3 queC 7-cyano-7-deazaguanine synthase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
A6UV33 8.84e-28 108 28 6 222 3 queC 7-cyano-7-deazaguanine synthase Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
Q30RN3 1.04e-27 108 31 5 214 3 queC 7-cyano-7-deazaguanine synthase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q0I671 1.46e-27 107 32 6 211 3 queC 7-cyano-7-deazaguanine synthase Synechococcus sp. (strain CC9311)
Q2IUE0 1.71e-27 107 32 4 211 3 queC2 7-cyano-7-deazaguanine synthase 2 Rhodopseudomonas palustris (strain HaA2)
A2STX4 2.49e-27 107 30 5 214 3 queC 7-cyano-7-deazaguanine synthase Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
Q3AR02 6.97e-27 106 32 5 212 3 queC 7-cyano-7-deazaguanine synthase Chlorobium chlorochromatii (strain CaD3)
Q8U4N3 1.14e-26 105 30 8 240 3 queC 7-cyano-7-deazaguanine synthase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
Q3B5F4 1.31e-26 105 32 5 213 3 queC 7-cyano-7-deazaguanine synthase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
A4SDQ0 1.66e-26 105 32 5 212 3 queC 7-cyano-7-deazaguanine synthase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
A2CDY7 1.71e-26 105 33 6 214 3 queC 7-cyano-7-deazaguanine synthase Prochlorococcus marinus (strain MIT 9303)
A1BHS4 6.01e-26 103 33 6 214 3 queC 7-cyano-7-deazaguanine synthase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
B3EGF5 8.08e-26 103 32 5 213 3 queC 7-cyano-7-deazaguanine synthase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
B4S6H3 1.73e-25 102 33 6 213 3 queC 7-cyano-7-deazaguanine synthase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q12WI3 2.39e-25 102 30 6 220 3 queC 7-cyano-7-deazaguanine synthase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
Q7V3W6 3.52e-25 101 32 6 214 3 queC 7-cyano-7-deazaguanine synthase Prochlorococcus marinus (strain MIT 9313)
Q58742 4.84e-25 101 31 9 232 3 queC 7-cyano-7-deazaguanine synthase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q3ADI5 9.12e-25 100 30 8 221 3 queC 7-cyano-7-deazaguanine synthase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q5JHU5 1.38e-24 100 30 8 240 3 queC 7-cyano-7-deazaguanine synthase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q6W2G5 2.93e-23 97 31 8 219 3 queC 7-cyano-7-deazaguanine synthase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
O27180 3.01e-23 96 31 8 215 3 queC 7-cyano-7-deazaguanine synthase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q5V0E6 6.1e-23 95 31 6 209 3 queC 7-cyano-7-deazaguanine synthase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
Q2NF51 8.19e-23 95 31 8 217 3 queC 7-cyano-7-deazaguanine synthase Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Q1GEY7 1.16e-22 95 34 9 223 3 queC 7-cyano-7-deazaguanine synthase Ruegeria sp. (strain TM1040)
B3QS09 2.1e-22 94 29 6 230 3 queC 7-cyano-7-deazaguanine synthase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
A6WXM7 6.05e-22 93 31 8 219 3 queC 7-cyano-7-deazaguanine synthase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
B0CIX5 1.03e-21 92 31 8 214 3 queC 7-cyano-7-deazaguanine synthase Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VSU2 1.03e-21 92 31 8 214 3 queC 7-cyano-7-deazaguanine synthase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YJI8 1.03e-21 92 31 8 214 3 queC 7-cyano-7-deazaguanine synthase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RFL5 1.03e-21 92 31 8 214 3 queC 7-cyano-7-deazaguanine synthase Brucella melitensis biotype 2 (strain ATCC 23457)
Q57AT2 1.03e-21 92 31 8 214 3 queC 7-cyano-7-deazaguanine synthase Brucella abortus biovar 1 (strain 9-941)
Q2YR96 1.03e-21 92 31 8 214 3 queC 7-cyano-7-deazaguanine synthase Brucella abortus (strain 2308)
B2S8M9 1.03e-21 92 31 8 214 3 queC 7-cyano-7-deazaguanine synthase Brucella abortus (strain S19)
Q46G70 1.03e-21 92 28 9 242 3 queC 7-cyano-7-deazaguanine synthase Methanosarcina barkeri (strain Fusaro / DSM 804)
Q8FYB3 1.05e-21 92 31 8 214 3 queC 7-cyano-7-deazaguanine synthase Brucella suis biovar 1 (strain 1330)
A9M959 1.05e-21 92 31 8 214 3 queC 7-cyano-7-deazaguanine synthase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q8UAM7 1.2e-21 92 32 7 214 3 queC 7-cyano-7-deazaguanine synthase Agrobacterium fabrum (strain C58 / ATCC 33970)
A1B9Q5 1.28e-21 92 31 6 225 3 queC 7-cyano-7-deazaguanine synthase Paracoccus denitrificans (strain Pd 1222)
A5GPN0 2.76e-21 91 30 6 213 3 queC 7-cyano-7-deazaguanine synthase Synechococcus sp. (strain WH7803)
Q9HHN8 3.4e-21 91 34 5 208 3 queC 7-cyano-7-deazaguanine synthase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R9W5 3.4e-21 91 34 5 208 3 queC 7-cyano-7-deazaguanine synthase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q92UN9 3.9e-21 91 31 8 219 3 queC 7-cyano-7-deazaguanine synthase Rhizobium meliloti (strain 1021)
B9JS46 8.91e-21 90 31 7 214 3 queC 7-cyano-7-deazaguanine synthase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
B1I3W2 1.16e-20 89 30 6 216 3 queC 7-cyano-7-deazaguanine synthase Desulforudis audaxviator (strain MP104C)
A0B6A6 1.31e-20 89 29 6 217 3 queC 7-cyano-7-deazaguanine synthase Methanothrix thermoacetophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT)
Q1MBE0 1.77e-20 89 30 7 213 3 queC 7-cyano-7-deazaguanine synthase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q5LM13 4.27e-20 88 30 6 217 3 queC 7-cyano-7-deazaguanine synthase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
B3Q0Y0 6.48e-20 88 31 8 213 3 queC 7-cyano-7-deazaguanine synthase Rhizobium etli (strain CIAT 652)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS00590
Feature type CDS
Gene queC
Product 7-cyano-7-deazaguanine synthase QueC
Location 152136 - 152834 (strand: -1)
Length 699 (nucleotides) / 232 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2118
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06508 Queuosine biosynthesis protein QueC

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0603 Translation, ribosomal structure and biogenesis (J) J 7-cyano-7-deazaguanine synthase (queuosine biosynthesis)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06920 7-cyano-7-deazaguanine synthase [EC:6.3.4.20] Folate biosynthesis
Metabolic pathways		 -

Protein Sequence

MKKTVVVFSGGQDSTTCLIQALEQYDEVHCITFNYGQRHKEEIEVAQRVSQLLGATAHKVLDVSLLNELAISSLTRDNIPVPDFKQSEQSDIPSTFVPGRNILFLTLAAIYAYQIGAESVITGVCETDFSGYPDCRDEFVKALNHAVNLGIARDIQFITPLMWLDKAQTWALADYYGKLDFVRHNTLTCYNGIQGDGCGQCAACHLRERGLHGYLQDKNAVMDAMKNKVGLK

Flanking regions ( +/- flanking 50bp)

ATATTATGCGTATTAATCCTTAAAAAATATCAATATTCAGGAGTATTCTGATGAAAAAAACGGTCGTTGTCTTTAGTGGTGGACAAGATTCGACAACCTGCCTAATCCAAGCACTAGAGCAGTATGATGAAGTTCATTGTATTACATTTAATTATGGACAACGTCATAAAGAAGAAATTGAGGTAGCACAAAGAGTCAGTCAATTATTAGGTGCAACCGCACATAAAGTTTTGGATGTCAGTTTACTCAATGAACTCGCTATCAGCAGCTTAACACGTGACAATATTCCTGTGCCTGATTTTAAACAGAGTGAACAAAGCGATATTCCTAGTACCTTTGTACCTGGTAGAAATATTCTATTTCTTACATTAGCCGCCATTTATGCTTATCAGATTGGTGCTGAAAGCGTTATTACTGGCGTATGTGAAACTGATTTCTCAGGTTATCCAGATTGTCGCGATGAGTTTGTTAAAGCTCTAAATCATGCGGTAAATTTAGGTATTGCTCGTGATATTCAGTTTATCACTCCGTTAATGTGGTTAGATAAAGCGCAAACTTGGGCACTCGCTGACTATTACGGTAAGTTAGATTTTGTACGCCACAACACCTTAACTTGTTATAACGGTATTCAAGGTGATGGTTGTGGTCAATGTGCCGCTTGCCATTTAAGAGAGCGTGGACTTCATGGCTATTTACAAGACAAAAATGCCGTCATGGACGCCATGAAAAATAAAGTTGGCCTTAAATAATCTGTCAAAAATGTGTTAGCTTTGTTTTCTGTGCGTTTACACCCGTAGCA