Homologs in group_2155

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15910 FBDBKF_15910 100.0 Morganella morganii S1 queC 7-cyano-7-deazaguanine synthase QueC
NLDBIP_17345 NLDBIP_17345 100.0 Morganella morganii S4 queC 7-cyano-7-deazaguanine synthase QueC
LHKJJB_17315 LHKJJB_17315 100.0 Morganella morganii S3 queC 7-cyano-7-deazaguanine synthase QueC
HKOGLL_17080 HKOGLL_17080 100.0 Morganella morganii S5 queC 7-cyano-7-deazaguanine synthase QueC
F4V73_RS16400 F4V73_RS16400 90.9 Morganella psychrotolerans queC 7-cyano-7-deazaguanine synthase QueC
PMI_RS00590 PMI_RS00590 79.7 Proteus mirabilis HI4320 queC 7-cyano-7-deazaguanine synthase QueC

Distribution of the homologs in the orthogroup group_2155

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2155

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B1LJK1 6.31e-143 401 81 1 232 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli (strain SMS-3-5 / SECEC)
Q1RF91 6.59e-143 401 82 1 231 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli (strain UTI89 / UPEC)
B7N8Z8 6.59e-143 401 82 1 231 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q8FKA4 6.59e-143 401 82 1 231 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TKJ7 6.59e-143 401 82 1 231 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1A8B3 6.59e-143 401 82 1 231 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli O1:K1 / APEC
B7MQG0 6.59e-143 401 82 1 231 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli O81 (strain ED1a)
B7NJ50 6.59e-143 401 82 1 231 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7MDA3 6.59e-143 401 82 1 231 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli O45:K1 (strain S88 / ExPEC)
Q3Z4V4 7.6e-143 401 82 1 231 3 queC 7-cyano-7-deazaguanine synthase Shigella sonnei (strain Ss046)
Q83M51 7.6e-143 401 82 1 231 3 queC 7-cyano-7-deazaguanine synthase Shigella flexneri
Q325F7 7.6e-143 401 82 1 231 3 queC 7-cyano-7-deazaguanine synthase Shigella boydii serotype 4 (strain Sb227)
B2U4P9 7.6e-143 401 82 1 231 3 queC 7-cyano-7-deazaguanine synthase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B6HZQ1 7.6e-143 401 82 1 231 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli (strain SE11)
A7ZXA2 7.6e-143 401 82 1 231 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli O9:H4 (strain HS)
A7ZIK2 7.6e-143 401 82 1 231 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli O139:H28 (strain E24377A / ETEC)
B7LMD5 1.07e-142 401 82 1 231 3 queC 7-cyano-7-deazaguanine synthase Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B5Z3V1 2.48e-142 400 81 1 231 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XE52 2.48e-142 400 81 1 231 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli O157:H7
Q0T7D9 3.61e-142 399 81 1 231 3 queC 7-cyano-7-deazaguanine synthase Shigella flexneri serotype 5b (strain 8401)
B7UJR7 3.73e-142 399 81 1 231 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
P77756 3.81e-142 399 81 1 231 1 queC 7-cyano-7-deazaguanine synthase Escherichia coli (strain K12)
B1XFN2 3.81e-142 399 81 1 231 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli (strain K12 / DH10B)
C4ZTK1 3.81e-142 399 81 1 231 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli (strain K12 / MC4100 / BW2952)
B1J004 4.74e-142 399 81 1 231 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
B7M3T7 4.74e-142 399 81 1 231 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli O8 (strain IAI1)
B4EU60 7.22e-142 399 80 0 231 3 queC 7-cyano-7-deazaguanine synthase Proteus mirabilis (strain HI4320)
Q32JK2 7.27e-142 399 81 1 231 3 queC 7-cyano-7-deazaguanine synthase Shigella dysenteriae serotype 1 (strain Sd197)
A6T5I7 1.17e-141 398 81 1 231 3 queC 7-cyano-7-deazaguanine synthase Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B7L681 1.44e-141 398 81 1 231 3 queC 7-cyano-7-deazaguanine synthase Escherichia coli (strain 55989 / EAEC)
B5Y0T5 3.71e-141 397 80 1 231 3 queC 7-cyano-7-deazaguanine synthase Klebsiella pneumoniae (strain 342)
A4W7B5 4.34e-141 397 81 1 231 3 queC 7-cyano-7-deazaguanine synthase Enterobacter sp. (strain 638)
A8AK09 7.27e-141 396 81 1 231 3 queC 7-cyano-7-deazaguanine synthase Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
B5BD76 1.03e-140 396 81 1 231 3 queC 7-cyano-7-deazaguanine synthase Salmonella paratyphi A (strain AKU_12601)
Q5PFP1 1.03e-140 396 81 1 231 3 queC 7-cyano-7-deazaguanine synthase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
C0Q7Y0 1.55e-140 395 81 1 231 3 queC 7-cyano-7-deazaguanine synthase Salmonella paratyphi C (strain RKS4594)
Q57SA8 1.55e-140 395 81 1 231 3 queC 7-cyano-7-deazaguanine synthase Salmonella choleraesuis (strain SC-B67)
Q7CR22 2.35e-140 395 81 1 231 3 queC 7-cyano-7-deazaguanine synthase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XEU3 2.35e-140 395 81 1 231 3 queC 7-cyano-7-deazaguanine synthase Salmonella typhi
B5QU45 2.35e-140 395 81 1 231 3 queC 7-cyano-7-deazaguanine synthase Salmonella enteritidis PT4 (strain P125109)
B5FKW0 2.35e-140 395 81 1 231 3 queC 7-cyano-7-deazaguanine synthase Salmonella dublin (strain CT_02021853)
B5EXJ5 2.35e-140 395 81 1 231 3 queC 7-cyano-7-deazaguanine synthase Salmonella agona (strain SL483)
B4SWU8 4.49e-140 394 81 1 231 3 queC 7-cyano-7-deazaguanine synthase Salmonella newport (strain SL254)
B4TMD3 9.46e-140 393 80 1 231 3 queC 7-cyano-7-deazaguanine synthase Salmonella schwarzengrund (strain CVM19633)
A9MM16 1.19e-139 393 80 1 232 3 queC 7-cyano-7-deazaguanine synthase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B4T9F0 1.24e-139 393 80 1 231 3 queC 7-cyano-7-deazaguanine synthase Salmonella heidelberg (strain SL476)
B5R6V6 1.24e-139 393 80 1 231 3 queC 7-cyano-7-deazaguanine synthase Salmonella gallinarum (strain 287/91 / NCTC 13346)
A9MWC2 2.06e-139 392 80 1 231 3 queC 7-cyano-7-deazaguanine synthase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
C6DB62 8.29e-138 389 79 1 231 3 queC 7-cyano-7-deazaguanine synthase Pectobacterium carotovorum subsp. carotovorum (strain PC1)
A1JNM3 3.5e-137 387 77 0 231 3 queC 7-cyano-7-deazaguanine synthase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q7N0M0 6.46e-137 386 78 0 231 3 queC 7-cyano-7-deazaguanine synthase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8GAR6 8.97e-137 386 76 0 231 3 queC 7-cyano-7-deazaguanine synthase Serratia proteamaculans (strain 568)
C5BCK3 2.39e-136 385 78 1 231 3 queC 7-cyano-7-deazaguanine synthase Edwardsiella ictaluri (strain 93-146)
Q6D820 5e-136 384 78 1 231 1 queC 7-cyano-7-deazaguanine synthase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A7MFJ8 8.55e-133 376 78 1 231 3 queC 7-cyano-7-deazaguanine synthase Cronobacter sakazakii (strain ATCC BAA-894)
Q2NV74 1.99e-132 375 76 1 232 3 queC 7-cyano-7-deazaguanine synthase Sodalis glossinidius (strain morsitans)
B1JHR4 2.25e-132 375 74 0 231 3 queC 7-cyano-7-deazaguanine synthase Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66DS7 2.25e-132 375 74 0 231 3 queC 7-cyano-7-deazaguanine synthase Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TPD5 2.25e-132 375 74 0 231 3 queC 7-cyano-7-deazaguanine synthase Yersinia pestis (strain Pestoides F)
Q1CL58 2.25e-132 375 74 0 231 3 queC 7-cyano-7-deazaguanine synthase Yersinia pestis bv. Antiqua (strain Nepal516)
A9QZP5 2.25e-132 375 74 0 231 3 queC 7-cyano-7-deazaguanine synthase Yersinia pestis bv. Antiqua (strain Angola)
Q8ZC72 2.25e-132 375 74 0 231 3 queC 7-cyano-7-deazaguanine synthase Yersinia pestis
B2K6W4 2.25e-132 375 74 0 231 3 queC 7-cyano-7-deazaguanine synthase Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C4L5 2.25e-132 375 74 0 231 3 queC 7-cyano-7-deazaguanine synthase Yersinia pestis bv. Antiqua (strain Antiqua)
A7FLB7 2.25e-132 375 74 0 231 3 queC 7-cyano-7-deazaguanine synthase Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B2VIU4 6.26e-128 363 73 1 231 3 queC 7-cyano-7-deazaguanine synthase Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A4SLT2 9.84e-128 363 73 1 231 3 queC 7-cyano-7-deazaguanine synthase Aeromonas salmonicida (strain A449)
A0KJA0 3.72e-126 359 73 1 231 3 queC 7-cyano-7-deazaguanine synthase Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q5E4H1 1.28e-121 347 69 1 226 3 queC 7-cyano-7-deazaguanine synthase Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5FF08 4.46e-121 346 68 1 226 3 queC 7-cyano-7-deazaguanine synthase Aliivibrio fischeri (strain MJ11)
B6EH68 8.16e-121 345 68 1 226 3 queC 7-cyano-7-deazaguanine synthase Aliivibrio salmonicida (strain LFI1238)
Q4K6M3 1.51e-120 345 69 1 230 3 queC2 7-cyano-7-deazaguanine synthase 2 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q6LTJ7 1.37e-118 340 68 1 225 3 queC 7-cyano-7-deazaguanine synthase Photobacterium profundum (strain SS9)
A1S6M5 3.94e-116 333 65 1 230 3 queC 7-cyano-7-deazaguanine synthase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B8E544 3.71e-115 332 68 1 223 3 queC 7-cyano-7-deazaguanine synthase Shewanella baltica (strain OS223)
A6WN68 1.31e-114 330 68 1 223 3 queC 7-cyano-7-deazaguanine synthase Shewanella baltica (strain OS185)
A7MW43 1.62e-114 330 67 1 225 3 queC 7-cyano-7-deazaguanine synthase Vibrio campbellii (strain ATCC BAA-1116)
A9L185 1.86e-114 330 68 1 223 3 queC 7-cyano-7-deazaguanine synthase Shewanella baltica (strain OS195)
C3LM61 2.06e-114 329 66 1 226 3 queC 7-cyano-7-deazaguanine synthase Vibrio cholerae serotype O1 (strain M66-2)
Q9KS93 2.06e-114 329 66 1 226 3 queC 7-cyano-7-deazaguanine synthase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F8G4 2.06e-114 329 66 1 226 3 queC 7-cyano-7-deazaguanine synthase Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A1RJY8 3.32e-114 329 68 1 223 3 queC 7-cyano-7-deazaguanine synthase Shewanella sp. (strain W3-18-1)
A4Y6J4 3.32e-114 329 68 1 223 3 queC 7-cyano-7-deazaguanine synthase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q7ML86 3.22e-113 326 66 1 225 3 queC 7-cyano-7-deazaguanine synthase Vibrio vulnificus (strain YJ016)
Q87P80 4.33e-113 326 65 1 225 3 queC 7-cyano-7-deazaguanine synthase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A8H532 2.59e-112 324 65 1 225 3 queC 7-cyano-7-deazaguanine synthase Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q8D985 5.02e-112 323 65 1 225 3 queC 7-cyano-7-deazaguanine synthase Vibrio vulnificus (strain CMCP6)
B0TSC0 6.44e-112 323 64 1 225 3 queC 7-cyano-7-deazaguanine synthase Shewanella halifaxensis (strain HAW-EB4)
B8CM62 1.58e-111 322 65 1 225 3 queC 7-cyano-7-deazaguanine synthase Shewanella piezotolerans (strain WP3 / JCM 13877)
Q1LTK2 8.39e-111 320 64 0 231 3 queC 7-cyano-7-deazaguanine synthase Baumannia cicadellinicola subsp. Homalodisca coagulata
Q12MM8 1.73e-110 319 64 1 229 3 queC 7-cyano-7-deazaguanine synthase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q8EE85 5.64e-110 318 68 1 218 3 queC 7-cyano-7-deazaguanine synthase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A3QEN0 7.19e-110 318 66 1 225 3 queC 7-cyano-7-deazaguanine synthase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q0HII5 6.63e-109 316 66 1 220 3 queC 7-cyano-7-deazaguanine synthase Shewanella sp. (strain MR-4)
A8FUY4 1.31e-108 315 64 1 225 3 queC 7-cyano-7-deazaguanine synthase Shewanella sediminis (strain HAW-EB3)
Q0HVF0 9.17e-108 313 65 1 220 3 queC 7-cyano-7-deazaguanine synthase Shewanella sp. (strain MR-7)
A0KX75 9.03e-107 310 65 1 220 3 queC 7-cyano-7-deazaguanine synthase Shewanella sp. (strain ANA-3)
Q082U2 2.92e-105 306 63 1 223 3 queC 7-cyano-7-deazaguanine synthase Shewanella frigidimarina (strain NCIMB 400)
Q65KI6 8.63e-94 276 60 2 214 3 queC 7-cyano-7-deazaguanine synthase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
A8FCH9 2.72e-93 275 58 2 219 3 queC 7-cyano-7-deazaguanine synthase Bacillus pumilus (strain SAFR-032)
Q9KAP3 7.72e-93 274 58 2 219 3 queC 7-cyano-7-deazaguanine synthase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A7Z3Y6 2.76e-92 273 59 2 214 3 queC 7-cyano-7-deazaguanine synthase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
O31675 5.82e-92 272 58 2 214 1 queC 7-cyano-7-deazaguanine synthase Bacillus subtilis (strain 168)
Q8CTH8 3.59e-88 263 56 2 217 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HR20 3.59e-88 263 56 2 217 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q5L1C0 4.98e-88 262 56 2 220 3 queC 7-cyano-7-deazaguanine synthase Geobacillus kaustophilus (strain HTA426)
C5D7Y2 9.38e-88 261 56 2 219 3 queC 7-cyano-7-deazaguanine synthase Geobacillus sp. (strain WCH70)
Q7A1I5 3.26e-87 260 54 2 220 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus aureus (strain MW2)
A8YZY3 3.26e-87 260 54 2 220 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus aureus (strain USA300 / TCH1516)
Q6GBB8 3.26e-87 260 54 2 220 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus aureus (strain MSSA476)
Q6GIT0 3.26e-87 260 54 2 220 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus aureus (strain MRSA252)
Q7A6U7 3.26e-87 260 54 2 220 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus aureus (strain N315)
Q99VR1 3.26e-87 260 54 2 220 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QF21 3.26e-87 260 54 2 220 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus aureus (strain Newman)
Q5HHV8 3.26e-87 260 54 2 220 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus aureus (strain COL)
A5IQR6 3.26e-87 260 54 2 220 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus aureus (strain JH9)
Q2G1X6 3.26e-87 260 54 2 220 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FIS8 3.26e-87 260 54 2 220 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus aureus (strain USA300)
A6TZJ0 3.26e-87 260 54 2 220 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus aureus (strain JH1)
A7WZJ4 3.26e-87 260 54 2 220 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus aureus (strain Mu3 / ATCC 700698)
A7GMN2 6.42e-87 259 56 2 222 3 queC 7-cyano-7-deazaguanine synthase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q5M4S5 7.22e-87 259 58 4 220 3 queC 7-cyano-7-deazaguanine synthase Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5M064 7.22e-87 259 58 4 220 3 queC 7-cyano-7-deazaguanine synthase Streptococcus thermophilus (strain CNRZ 1066)
B7IN35 7.56e-87 259 56 2 219 3 queC 7-cyano-7-deazaguanine synthase Bacillus cereus (strain G9842)
Q2YSL9 9.22e-87 259 54 2 220 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus aureus (strain bovine RF122 / ET3-1)
A9VKR8 9.31e-87 259 55 2 219 3 queC 7-cyano-7-deazaguanine synthase Bacillus mycoides (strain KBAB4)
B1HPF6 1.13e-86 258 54 2 218 3 queC 7-cyano-7-deazaguanine synthase Lysinibacillus sphaericus (strain C3-41)
B9IUT0 1.7e-86 258 56 2 219 3 queC 7-cyano-7-deazaguanine synthase Bacillus cereus (strain Q1)
B7HK63 1.7e-86 258 56 2 219 3 queC 7-cyano-7-deazaguanine synthase Bacillus cereus (strain AH187)
A6LWG7 2.11e-86 258 55 2 217 3 queC 7-cyano-7-deazaguanine synthase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q6HLK6 2.23e-86 258 56 2 219 3 queC 7-cyano-7-deazaguanine synthase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63E31 2.23e-86 258 56 2 219 3 queC 7-cyano-7-deazaguanine synthase Bacillus cereus (strain ZK / E33L)
C1EM49 2.23e-86 258 56 2 219 3 queC 7-cyano-7-deazaguanine synthase Bacillus cereus (strain 03BB102)
Q73BG0 2.23e-86 258 56 2 219 3 queC 7-cyano-7-deazaguanine synthase Bacillus cereus (strain ATCC 10987 / NRS 248)
A0RBG1 2.23e-86 258 56 2 219 3 queC 7-cyano-7-deazaguanine synthase Bacillus thuringiensis (strain Al Hakam)
Q81G69 2.81e-86 258 56 2 219 3 queC 7-cyano-7-deazaguanine synthase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B7JFS4 3e-86 258 56 2 219 3 queC 7-cyano-7-deazaguanine synthase Bacillus cereus (strain AH820)
Q81TC7 3e-86 258 56 2 219 3 queC 7-cyano-7-deazaguanine synthase Bacillus anthracis
C3LAL0 3e-86 258 56 2 219 3 queC 7-cyano-7-deazaguanine synthase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P4F6 3e-86 258 56 2 219 3 queC 7-cyano-7-deazaguanine synthase Bacillus anthracis (strain A0248)
Q03L16 3.6e-86 257 58 4 220 3 queC 7-cyano-7-deazaguanine synthase Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
B7HH96 9.87e-86 256 55 2 219 3 queC 7-cyano-7-deazaguanine synthase Bacillus cereus (strain B4264)
A4ILN7 1.02e-85 256 55 2 222 3 queC 7-cyano-7-deazaguanine synthase Geobacillus thermodenitrificans (strain NG80-2)
Q49VQ7 2.45e-85 255 55 2 217 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q4L4D0 9.7e-85 254 54 2 218 3 queC 7-cyano-7-deazaguanine synthase Staphylococcus haemolyticus (strain JCSC1435)
Q5WG41 1.32e-84 253 55 2 218 3 queC 7-cyano-7-deazaguanine synthase Shouchella clausii (strain KSM-K16)
B7GLA4 5.44e-84 252 54 2 219 3 queC 7-cyano-7-deazaguanine synthase Anoxybacillus flavithermus (strain DSM 21510 / WK1)
B1YFM6 2.4e-83 250 56 2 216 3 queC 7-cyano-7-deazaguanine synthase Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q8DUK7 3.16e-83 249 54 4 220 3 queC 7-cyano-7-deazaguanine synthase Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
C4L0V4 9.24e-81 243 53 2 213 3 queC 7-cyano-7-deazaguanine synthase Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b)
Q8A7F8 3.55e-80 242 51 2 216 3 queC 7-cyano-7-deazaguanine synthase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
A6L2J2 2.95e-79 240 53 3 213 3 queC 7-cyano-7-deazaguanine synthase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q64WB0 8.71e-78 236 49 2 216 3 queC 7-cyano-7-deazaguanine synthase Bacteroides fragilis (strain YCH46)
Q5LFI6 8.71e-78 236 49 2 216 3 queC 7-cyano-7-deazaguanine synthase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q97D53 1.25e-77 236 54 2 209 3 queC 7-cyano-7-deazaguanine synthase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
C3KVW4 1.87e-77 235 54 4 211 3 queC 7-cyano-7-deazaguanine synthase Clostridium botulinum (strain 657 / Type Ba4)
B1IL95 9.93e-77 233 54 4 211 3 queC 7-cyano-7-deazaguanine synthase Clostridium botulinum (strain Okra / Type B1)
A7GDP2 1.22e-76 233 54 4 211 3 queC 7-cyano-7-deazaguanine synthase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
C1FN27 1.41e-76 233 52 5 221 3 queC 7-cyano-7-deazaguanine synthase Clostridium botulinum (strain Kyoto / Type A2)
A5I232 1.62e-76 233 54 4 211 3 queC 7-cyano-7-deazaguanine synthase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FU68 1.62e-76 233 54 4 211 3 queC 7-cyano-7-deazaguanine synthase Clostridium botulinum (strain ATCC 19397 / Type A)
A0Q1F7 8.72e-76 231 50 2 209 3 queC 7-cyano-7-deazaguanine synthase Clostridium novyi (strain NT)
B1L1S2 1.52e-75 230 54 4 211 3 queC 7-cyano-7-deazaguanine synthase Clostridium botulinum (strain Loch Maree / Type A3)
Q8K986 5.2e-75 229 45 1 227 3 queC 7-cyano-7-deazaguanine synthase Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
A9M1Y9 8.53e-75 228 51 3 222 3 queC 7-cyano-7-deazaguanine synthase Neisseria meningitidis serogroup C (strain 053442)
Q9JVT8 1.25e-73 225 51 4 222 3 queC 7-cyano-7-deazaguanine synthase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q9K0Q9 3.33e-73 224 51 4 222 3 queC 7-cyano-7-deazaguanine synthase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A1KSD4 5.82e-73 224 51 4 222 3 queC 7-cyano-7-deazaguanine synthase Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
A6VQW6 8.16e-69 214 49 4 222 3 queC 7-cyano-7-deazaguanine synthase Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q65RE8 1.28e-68 213 49 5 219 3 queC 7-cyano-7-deazaguanine synthase Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q9CP69 5.47e-68 211 48 4 220 3 queC 7-cyano-7-deazaguanine synthase Pasteurella multocida (strain Pm70)
Q4QLA8 8.38e-68 211 47 4 219 3 queC 7-cyano-7-deazaguanine synthase Haemophilus influenzae (strain 86-028NP)
B4RQ61 1.71e-67 210 49 4 222 3 queC 7-cyano-7-deazaguanine synthase Neisseria gonorrhoeae (strain NCCP11945)
Q5FA99 1.78e-67 210 48 4 223 3 queC 7-cyano-7-deazaguanine synthase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A5UCR9 3.64e-67 209 47 4 219 3 queC 7-cyano-7-deazaguanine synthase Haemophilus influenzae (strain PittEE)
A6LIS9 4.03e-67 209 48 3 216 3 queC 7-cyano-7-deazaguanine synthase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
B8F6L5 8.5e-67 208 47 4 221 3 queC 7-cyano-7-deazaguanine synthase Glaesserella parasuis serovar 5 (strain SH0165)
Q7VNH6 5.27e-66 206 48 5 221 3 queC 7-cyano-7-deazaguanine synthase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P44124 2e-65 205 47 5 220 3 queC 7-cyano-7-deazaguanine synthase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A3N1A3 5.99e-65 203 45 4 220 3 queC 7-cyano-7-deazaguanine synthase Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B3H1X8 1e-64 203 45 4 220 3 queC 7-cyano-7-deazaguanine synthase Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
B0BQ32 1.72e-64 202 45 4 220 3 queC 7-cyano-7-deazaguanine synthase Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
Q220R7 6.58e-64 201 46 5 243 3 queC 7-cyano-7-deazaguanine synthase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q63YL0 8.28e-63 199 45 6 238 3 queC 7-cyano-7-deazaguanine synthase Burkholderia pseudomallei (strain K96243)
A3N4E3 8.28e-63 199 45 6 238 3 queC 7-cyano-7-deazaguanine synthase Burkholderia pseudomallei (strain 668)
Q3JXD3 8.28e-63 199 45 6 238 3 queC 7-cyano-7-deazaguanine synthase Burkholderia pseudomallei (strain 1710b)
A3NQ33 8.28e-63 199 45 6 238 3 queC 7-cyano-7-deazaguanine synthase Burkholderia pseudomallei (strain 1106a)
A1V788 8.28e-63 199 45 6 238 3 queC 7-cyano-7-deazaguanine synthase Burkholderia mallei (strain SAVP1)
Q62MS6 8.28e-63 199 45 6 238 3 queC 7-cyano-7-deazaguanine synthase Burkholderia mallei (strain ATCC 23344)
A2S8H7 8.28e-63 199 45 6 238 3 queC 7-cyano-7-deazaguanine synthase Burkholderia mallei (strain NCTC 10229)
A3MNQ3 8.28e-63 199 45 6 238 3 queC 7-cyano-7-deazaguanine synthase Burkholderia mallei (strain NCTC 10247)
Q0A550 9.85e-63 198 48 4 225 3 queC 7-cyano-7-deazaguanine synthase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q2T2A4 1.38e-62 198 44 6 240 3 queC 7-cyano-7-deazaguanine synthase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
A9AC62 3.33e-62 197 46 6 230 3 queC 7-cyano-7-deazaguanine synthase Burkholderia multivorans (strain ATCC 17616 / 249)
Q0BAU3 5.03e-62 197 44 6 240 3 queC 7-cyano-7-deazaguanine synthase Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YPW9 5.03e-62 197 44 6 240 3 queC 7-cyano-7-deazaguanine synthase Burkholderia ambifaria (strain MC40-6)
A4JIU1 6.67e-62 196 45 6 230 3 queC 7-cyano-7-deazaguanine synthase Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q5NNR3 1.49e-61 196 44 5 233 3 queC 7-cyano-7-deazaguanine synthase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
B4E7W5 2.49e-61 195 44 6 230 3 queC 7-cyano-7-deazaguanine synthase Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q1BSK1 2.6e-61 195 44 6 230 3 queC 7-cyano-7-deazaguanine synthase Burkholderia orbicola (strain AU 1054)
B1K0I8 2.6e-61 195 44 6 230 3 queC 7-cyano-7-deazaguanine synthase Burkholderia orbicola (strain MC0-3)
A0KBJ0 2.6e-61 195 44 6 230 3 queC 7-cyano-7-deazaguanine synthase Burkholderia cenocepacia (strain HI2424)
Q39BV2 3.97e-61 194 44 6 230 3 queC 7-cyano-7-deazaguanine synthase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B2T1L3 4.62e-61 194 44 7 235 3 queC 7-cyano-7-deazaguanine synthase Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q146Z6 5.75e-61 194 45 7 235 3 queC 7-cyano-7-deazaguanine synthase Paraburkholderia xenovorans (strain LB400)
A6T2X9 1.36e-60 193 44 7 233 3 queC 7-cyano-7-deazaguanine synthase Janthinobacterium sp. (strain Marseille)
A4G964 2.07e-60 192 44 5 231 3 queC 7-cyano-7-deazaguanine synthase Herminiimonas arsenicoxydans
Q07ML3 5.77e-60 191 45 5 235 3 queC 7-cyano-7-deazaguanine synthase Rhodopseudomonas palustris (strain BisA53)
A1TIG3 6.18e-60 191 42 5 235 3 queC 7-cyano-7-deazaguanine synthase Paracidovorax citrulli (strain AAC00-1)
A1WSR5 1.36e-59 190 44 6 234 3 queC 7-cyano-7-deazaguanine synthase Verminephrobacter eiseniae (strain EF01-2)
Q1QM87 2.05e-59 190 45 7 235 3 queC 7-cyano-7-deazaguanine synthase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
B2JJV1 2.58e-59 190 44 7 233 3 queC 7-cyano-7-deazaguanine synthase Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q89LP8 4.3e-59 189 44 5 235 3 queC 7-cyano-7-deazaguanine synthase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q12FK2 8.11e-59 188 48 5 231 3 queC 7-cyano-7-deazaguanine synthase Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q2IWJ9 1.1e-58 188 45 5 231 3 queC1 7-cyano-7-deazaguanine synthase 1 Rhodopseudomonas palustris (strain HaA2)
Q3SSM7 1.27e-58 188 44 6 235 3 queC 7-cyano-7-deazaguanine synthase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A1W9G0 1.63e-58 187 44 6 235 3 queC 7-cyano-7-deazaguanine synthase Acidovorax sp. (strain JS42)
B9MBJ3 1.63e-58 187 44 6 235 3 queC 7-cyano-7-deazaguanine synthase Acidovorax ebreus (strain TPSY)
A8IMX7 1.83e-58 187 44 4 233 3 queC 7-cyano-7-deazaguanine synthase Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q136L0 4.29e-58 186 44 5 233 3 queC 7-cyano-7-deazaguanine synthase Rhodopseudomonas palustris (strain BisB5)
A4YUN8 5.02e-58 186 44 6 233 3 queC 7-cyano-7-deazaguanine synthase Bradyrhizobium sp. (strain ORS 278)
A5EJ03 5.8e-58 186 44 7 233 3 queC 7-cyano-7-deazaguanine synthase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A1VJX7 1.13e-57 186 47 5 229 3 queC 7-cyano-7-deazaguanine synthase Polaromonas naphthalenivorans (strain CJ2)
A2SCE3 1.37e-57 185 43 5 233 3 queC 7-cyano-7-deazaguanine synthase Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q213Y7 2.35e-57 185 45 5 231 3 queC 7-cyano-7-deazaguanine synthase Rhodopseudomonas palustris (strain BisB18)
B8H3X3 3.49e-57 184 43 6 237 3 queC 7-cyano-7-deazaguanine synthase Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A3P2 3.49e-57 184 43 6 237 3 queC 7-cyano-7-deazaguanine synthase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q2KZT1 4.27e-57 184 46 5 231 3 queC 7-cyano-7-deazaguanine synthase Bordetella avium (strain 197N)
Q1MQ73 5.1e-57 184 41 6 238 3 queC 7-cyano-7-deazaguanine synthase Lawsonia intracellularis (strain PHE/MN1-00)
B1Y8J4 5.43e-57 184 43 4 235 3 queC 7-cyano-7-deazaguanine synthase Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
Q7M8H4 9.91e-57 183 44 2 220 3 queC 7-cyano-7-deazaguanine synthase Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q17XR6 1.02e-56 182 41 3 220 3 queC 7-cyano-7-deazaguanine synthase Helicobacter acinonychis (strain Sheeba)
B2UTI7 1.04e-56 182 40 2 219 3 queC 7-cyano-7-deazaguanine synthase Helicobacter pylori (strain Shi470)
B6JLM6 1.86e-56 182 41 2 218 3 queC 7-cyano-7-deazaguanine synthase Helicobacter pylori (strain P12)
B3QKK5 2.19e-56 182 43 5 233 3 queC 7-cyano-7-deazaguanine synthase Rhodopseudomonas palustris (strain TIE-1)
Q6N608 2.26e-56 182 43 5 233 3 queC 7-cyano-7-deazaguanine synthase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
A1VB03 2.54e-56 182 43 7 234 3 queC 7-cyano-7-deazaguanine synthase Nitratidesulfovibrio vulgaris (strain DP4)
Q728E4 2.54e-56 182 43 7 234 3 queC 7-cyano-7-deazaguanine synthase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
B5Z711 2.98e-56 181 40 2 220 3 queC 7-cyano-7-deazaguanine synthase Helicobacter pylori (strain G27)
Q1GPS4 4.96e-56 181 45 7 231 3 queC2 7-cyano-7-deazaguanine synthase 2 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q1CTN3 5.82e-56 181 41 2 216 3 queC 7-cyano-7-deazaguanine synthase Helicobacter pylori (strain HPAG1)
Q7W0D1 5.83e-56 181 45 5 233 3 queC 7-cyano-7-deazaguanine synthase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WQB2 5.83e-56 181 45 5 233 3 queC 7-cyano-7-deazaguanine synthase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q7WCA8 6.5e-56 181 45 5 233 3 queC 7-cyano-7-deazaguanine synthase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
A1WY18 1.64e-55 180 44 5 229 3 queC 7-cyano-7-deazaguanine synthase Halorhodospira halophila (strain DSM 244 / SL1)
A9W222 1.91e-55 180 45 6 236 3 queC 7-cyano-7-deazaguanine synthase Methylorubrum extorquens (strain PA1)
O25356 4.85e-55 178 39 2 223 3 queC 7-cyano-7-deazaguanine synthase Helicobacter pylori (strain ATCC 700392 / 26695)
B0SX50 5.77e-55 179 43 6 239 3 queC 7-cyano-7-deazaguanine synthase Caulobacter sp. (strain K31)
A7HXX1 8.23e-55 178 42 6 236 3 queC 7-cyano-7-deazaguanine synthase Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A9HRF6 2.56e-54 177 42 5 234 3 queC 7-cyano-7-deazaguanine synthase Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q7NSB9 2.85e-54 177 45 5 212 3 queC 7-cyano-7-deazaguanine synthase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q9ZLJ7 7.02e-54 175 39 2 218 3 queC 7-cyano-7-deazaguanine synthase Helicobacter pylori (strain J99 / ATCC 700824)
B7KR63 9.15e-54 176 45 6 235 3 queC 7-cyano-7-deazaguanine synthase Methylorubrum extorquens (strain CM4 / NCIMB 13688)
Q0BQ87 3.83e-53 174 42 7 240 3 queC 7-cyano-7-deazaguanine synthase Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q5FQR2 5.73e-53 174 42 5 235 3 queC 7-cyano-7-deazaguanine synthase Gluconobacter oxydans (strain 621H)
C1D6L0 7.01e-53 173 42 4 210 3 queC 7-cyano-7-deazaguanine synthase Laribacter hongkongensis (strain HLHK9)
Q7NCE2 9.56e-53 173 45 6 218 3 queC 7-cyano-7-deazaguanine synthase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q98AM3 2.08e-52 172 41 5 239 3 queC2 7-cyano-7-deazaguanine synthase 2 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q0ARS7 1.6e-51 170 40 4 231 3 queC 7-cyano-7-deazaguanine synthase Maricaulis maris (strain MCS10)
Q0C4T2 2.77e-50 167 39 6 241 3 queC 7-cyano-7-deazaguanine synthase Hyphomonas neptunium (strain ATCC 15444)
Q8ETE9 8.38e-48 160 39 4 213 3 queC 7-cyano-7-deazaguanine synthase Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8F964 5.37e-47 158 41 6 215 3 queC 7-cyano-7-deazaguanine synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72VK9 5.37e-47 158 41 6 215 3 queC 7-cyano-7-deazaguanine synthase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
A7HHA2 1.93e-46 157 43 5 217 3 queC 7-cyano-7-deazaguanine synthase Anaeromyxobacter sp. (strain Fw109-5)
Q24VU8 8.54e-45 152 39 5 216 3 queC2 7-cyano-7-deazaguanine synthase 2 Desulfitobacterium hafniense (strain Y51)
Q0VRI8 1.36e-44 151 41 7 225 3 queC 7-cyano-7-deazaguanine synthase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
B8G1I4 1.4e-44 152 38 5 216 3 queC 7-cyano-7-deazaguanine synthase Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q21HP4 3.02e-44 150 39 6 217 3 queC 7-cyano-7-deazaguanine synthase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
A3DK21 5.31e-44 150 41 5 216 3 queC 7-cyano-7-deazaguanine synthase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q5WSS7 9.48e-44 149 40 8 222 3 queC 7-cyano-7-deazaguanine synthase Legionella pneumophila (strain Lens)
A5N597 1.12e-43 149 40 5 213 3 queC 7-cyano-7-deazaguanine synthase Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DYU5 1.12e-43 149 40 5 213 3 queC 7-cyano-7-deazaguanine synthase Clostridium kluyveri (strain NBRC 12016)
Q5ZRJ5 1.43e-43 149 40 8 222 3 queC 7-cyano-7-deazaguanine synthase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q055M9 1.91e-43 149 40 6 215 3 queC 7-cyano-7-deazaguanine synthase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04PP1 1.91e-43 149 40 6 215 3 queC 7-cyano-7-deazaguanine synthase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q2IG55 3.71e-43 148 43 6 217 3 queC 7-cyano-7-deazaguanine synthase Anaeromyxobacter dehalogenans (strain 2CP-C)
Q6F9A3 6.95e-43 147 41 8 215 3 queC 7-cyano-7-deazaguanine synthase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q5X101 2.1e-42 146 40 8 222 3 queC 7-cyano-7-deazaguanine synthase Legionella pneumophila (strain Paris)
A5II59 8.33e-42 144 40 8 222 3 queC 7-cyano-7-deazaguanine synthase Legionella pneumophila (strain Corby)
A9NBS5 1.04e-41 144 36 5 217 3 queC 7-cyano-7-deazaguanine synthase Coxiella burnetii (strain RSA 331 / Henzerling II)
A0L4R8 2.04e-41 144 41 8 218 3 queC 7-cyano-7-deazaguanine synthase Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A5WGB5 3.21e-41 144 37 8 232 3 queC 7-cyano-7-deazaguanine synthase Psychrobacter sp. (strain PRwf-1)
A6V9Z6 3.48e-41 143 39 7 220 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas aeruginosa (strain PA7)
Q83A28 8.9e-41 142 36 5 217 3 queC 7-cyano-7-deazaguanine synthase Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9KDD3 1.1e-40 142 36 5 217 3 queC 7-cyano-7-deazaguanine synthase Coxiella burnetii (strain Dugway 5J108-111)
Q9I4Z2 1.38e-40 141 39 7 220 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02ID8 1.38e-40 141 39 7 220 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas aeruginosa (strain UCBPP-PA14)
B7UXV6 1.38e-40 141 39 7 220 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas aeruginosa (strain LESB58)
Q478G3 1.71e-40 141 39 6 217 3 queC 7-cyano-7-deazaguanine synthase Dechloromonas aromatica (strain RCB)
Q31H76 6.26e-40 140 37 6 219 3 queC 7-cyano-7-deazaguanine synthase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q9HJL6 6.26e-40 140 39 7 215 3 queC 7-cyano-7-deazaguanine synthase Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165)
Q609K0 8.04e-40 139 39 6 218 3 queC 7-cyano-7-deazaguanine synthase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A5CWP9 1.02e-39 139 38 7 215 3 queC 7-cyano-7-deazaguanine synthase Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q1I6F8 1.66e-39 139 38 6 218 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas entomophila (strain L48)
Q979P0 7.29e-39 137 38 7 215 3 queC 7-cyano-7-deazaguanine synthase Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1)
B2FRM5 8.76e-39 137 39 7 217 3 queC 7-cyano-7-deazaguanine synthase Stenotrophomonas maltophilia (strain K279a)
Q48FD4 1.39e-38 136 38 6 216 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q8Y1F2 2.08e-38 135 37 6 218 3 queC 7-cyano-7-deazaguanine synthase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q1QCP3 2.65e-38 136 37 9 230 3 queC 7-cyano-7-deazaguanine synthase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
B0KTI3 3.04e-38 135 38 6 218 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas putida (strain GB-1)
Q4FTN4 3.15e-38 136 37 9 230 3 queC 7-cyano-7-deazaguanine synthase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q4ZWK2 5.28e-38 135 39 7 221 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas syringae pv. syringae (strain B728a)
Q6KZF9 5.49e-38 135 39 8 220 3 queC 7-cyano-7-deazaguanine synthase Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 / KAW 2/3)
A1AWK9 6.37e-38 135 37 6 215 3 queC 7-cyano-7-deazaguanine synthase Ruthia magnifica subsp. Calyptogena magnifica
Q5P4Z2 6.45e-38 134 38 7 222 3 queC 7-cyano-7-deazaguanine synthase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q15RL9 7.41e-38 134 37 7 213 3 queC 7-cyano-7-deazaguanine synthase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B1JD61 1.02e-37 134 37 6 218 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas putida (strain W619)
Q4K7E8 1.45e-37 134 38 6 218 3 queC1 7-cyano-7-deazaguanine synthase 1 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A4VN94 2.1e-37 133 38 7 223 3 queC 7-cyano-7-deazaguanine synthase Stutzerimonas stutzeri (strain A1501)
Q9WWW8 2.37e-37 133 37 6 218 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas putida
Q88NI3 2.37e-37 133 37 6 218 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q2LVL3 2.61e-37 133 38 10 224 3 queC 7-cyano-7-deazaguanine synthase Syntrophus aciditrophicus (strain SB)
A1ANI8 3.13e-37 133 40 7 217 3 queC 7-cyano-7-deazaguanine synthase Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
A5VZV6 3.13e-37 132 37 6 218 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
A6Q342 3.27e-37 132 35 6 213 3 queC 7-cyano-7-deazaguanine synthase Nitratiruptor sp. (strain SB155-2)
B4ST23 3.35e-37 132 38 7 217 3 queC 7-cyano-7-deazaguanine synthase Stenotrophomonas maltophilia (strain R551-3)
Q480C9 3.75e-37 132 36 6 212 3 queC1 7-cyano-7-deazaguanine synthase 1 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q87Y44 4.46e-37 132 38 7 216 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B2U7H6 4.76e-37 132 36 6 218 3 queC 7-cyano-7-deazaguanine synthase Ralstonia pickettii (strain 12J)
C3JYR8 5.18e-37 132 37 6 218 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas fluorescens (strain SBW25)
A7ZCA8 6.06e-37 132 36 5 214 3 queC 7-cyano-7-deazaguanine synthase Campylobacter concisus (strain 13826)
C4XPJ3 6.85e-37 132 37 6 219 3 queC 7-cyano-7-deazaguanine synthase Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q39R35 1.7e-36 131 40 8 217 3 queC 7-cyano-7-deazaguanine synthase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A6WGA4 1.75e-36 131 40 8 222 3 queC 7-cyano-7-deazaguanine synthase Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216)
A7GXH1 1.75e-36 130 38 6 216 3 queC 7-cyano-7-deazaguanine synthase Campylobacter curvus (strain 525.92)
C6E7E7 2.08e-36 130 37 8 217 3 queC 7-cyano-7-deazaguanine synthase Geobacter sp. (strain M21)
Q7UFU6 2.22e-36 131 37 7 222 3 queC 7-cyano-7-deazaguanine synthase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
A1K2H5 2.38e-36 130 38 7 221 3 queC 7-cyano-7-deazaguanine synthase Azoarcus sp. (strain BH72)
Q2S7U9 2.49e-36 130 35 5 214 3 queC 7-cyano-7-deazaguanine synthase Hahella chejuensis (strain KCTC 2396)
A6VX48 3.07e-36 130 37 6 208 3 queC 7-cyano-7-deazaguanine synthase Marinomonas sp. (strain MWYL1)
B5EDQ7 3.13e-36 130 37 8 217 3 queC 7-cyano-7-deazaguanine synthase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q9PCC3 4.14e-36 130 37 9 230 3 queC 7-cyano-7-deazaguanine synthase Xylella fastidiosa (strain 9a5c)
Q74FW9 4.66e-36 130 39 8 221 3 queC 7-cyano-7-deazaguanine synthase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A8GPK3 7.37e-36 129 34 5 215 3 queC 7-cyano-7-deazaguanine synthase Rickettsia akari (strain Hartford)
B4RTX3 9.42e-36 129 36 6 212 3 queC 7-cyano-7-deazaguanine synthase Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q3JER4 9.81e-36 129 37 7 215 3 queC 7-cyano-7-deazaguanine synthase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A4XRT0 1.08e-35 129 36 6 216 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas mendocina (strain ymp)
B8FMW6 1.49e-35 129 36 7 222 3 queC 7-cyano-7-deazaguanine synthase Desulfatibacillum aliphaticivorans
Q474K5 2.01e-35 128 36 7 219 3 queC 7-cyano-7-deazaguanine synthase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q0K7W8 2.76e-35 128 35 6 218 3 queC 7-cyano-7-deazaguanine synthase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B3PC22 2.82e-35 127 37 6 219 3 queC 7-cyano-7-deazaguanine synthase Cellvibrio japonicus (strain Ueda107)
A5G8S2 3.18e-35 127 38 8 217 3 queC 7-cyano-7-deazaguanine synthase Geotalea uraniireducens (strain Rf4)
Q8P6F6 4.55e-35 127 40 7 217 3 queC 7-cyano-7-deazaguanine synthase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RPZ6 4.55e-35 127 40 7 217 3 queC 7-cyano-7-deazaguanine synthase Xanthomonas campestris pv. campestris (strain B100)
Q4UXK8 4.55e-35 127 40 7 217 3 queC 7-cyano-7-deazaguanine synthase Xanthomonas campestris pv. campestris (strain 8004)
A0LJR5 5.29e-35 127 36 6 218 3 queC 7-cyano-7-deazaguanine synthase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q2Y5H4 6.03e-35 127 36 6 219 3 queC 7-cyano-7-deazaguanine synthase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q1CYI2 6.44e-35 127 38 7 223 3 queC 7-cyano-7-deazaguanine synthase Myxococcus xanthus (strain DK1622)
B0U2I4 7.25e-35 127 36 9 230 3 queC 7-cyano-7-deazaguanine synthase Xylella fastidiosa (strain M12)
Q3A090 8.51e-35 127 38 7 217 3 queC 7-cyano-7-deazaguanine synthase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q3K7W9 1.02e-34 126 37 6 216 3 queC 7-cyano-7-deazaguanine synthase Pseudomonas fluorescens (strain Pf0-1)
Q87CW1 1.04e-34 126 36 9 230 3 queC 7-cyano-7-deazaguanine synthase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I4Y4 1.04e-34 126 36 9 230 3 queC 7-cyano-7-deazaguanine synthase Xylella fastidiosa (strain M23)
B0SK77 1.14e-34 127 35 7 230 3 queC 7-cyano-7-deazaguanine synthase Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris)
B0S9S9 1.14e-34 127 35 7 230 3 queC 7-cyano-7-deazaguanine synthase Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames)
Q2N612 1.33e-34 126 37 8 224 3 queC 7-cyano-7-deazaguanine synthase Erythrobacter litoralis (strain HTCC2594)
Q4UMZ0 1.33e-34 126 33 5 212 3 queC 7-cyano-7-deazaguanine synthase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
A7H1A8 1.42e-34 126 36 7 216 3 queC 7-cyano-7-deazaguanine synthase Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A7I7A4 1.79e-34 125 38 4 205 3 queC 7-cyano-7-deazaguanine synthase Methanoregula boonei (strain DSM 21154 / JCM 14090 / 6A8)
B9M0M7 1.83e-34 125 38 8 221 3 queC 7-cyano-7-deazaguanine synthase Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
B0C253 2.38e-34 125 36 7 216 3 queC 7-cyano-7-deazaguanine synthase Acaryochloris marina (strain MBIC 11017)
Q7UZH5 2.39e-34 125 34 7 221 3 queC 7-cyano-7-deazaguanine synthase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
A2BTS3 2.5e-34 125 33 7 226 3 queC 7-cyano-7-deazaguanine synthase Prochlorococcus marinus (strain AS9601)
A1VX95 2.66e-34 125 35 7 216 3 queC 7-cyano-7-deazaguanine synthase Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q1GYT5 3.09e-34 125 36 5 216 3 queC 7-cyano-7-deazaguanine synthase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
B3R5T4 3.38e-34 125 34 6 218 3 queC 7-cyano-7-deazaguanine synthase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
A8EWF5 3.62e-34 125 35 5 214 3 queC 7-cyano-7-deazaguanine synthase Aliarcobacter butzleri (strain RM4018)
Q5HXE2 3.67e-34 125 34 5 215 3 queC 7-cyano-7-deazaguanine synthase Campylobacter jejuni (strain RM1221)
P0C634 3.67e-34 125 34 5 215 3 queC 7-cyano-7-deazaguanine synthase Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q317V0 4.85e-34 124 35 7 214 3 queC 7-cyano-7-deazaguanine synthase Prochlorococcus marinus (strain MIT 9312)
A1STX3 5.05e-34 124 36 8 222 3 queC 7-cyano-7-deazaguanine synthase Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q5QUZ6 5.6e-34 124 35 6 220 3 queC 7-cyano-7-deazaguanine synthase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A3PFI0 5.82e-34 124 34 8 228 3 queC 7-cyano-7-deazaguanine synthase Prochlorococcus marinus (strain MIT 9301)
Q1LJY1 5.96e-34 124 36 8 219 3 queC 7-cyano-7-deazaguanine synthase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B9L986 6.49e-34 124 35 5 216 3 queC 7-cyano-7-deazaguanine synthase Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
Q8PHW1 6.83e-34 124 38 7 217 3 queC 7-cyano-7-deazaguanine synthase Xanthomonas axonopodis pv. citri (strain 306)
A8FJH9 8.37e-34 124 34 5 215 3 queC 7-cyano-7-deazaguanine synthase Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
A7I1D0 8.4e-34 124 35 5 212 3 queC 7-cyano-7-deazaguanine synthase Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
B2IUR7 1.51e-33 123 35 6 213 3 queC 7-cyano-7-deazaguanine synthase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
A4XFR8 1.56e-33 123 35 4 205 3 queC 7-cyano-7-deazaguanine synthase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q68W43 1.74e-33 123 34 7 222 3 queC 7-cyano-7-deazaguanine synthase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
A6Q9Q9 1.95e-33 123 34 6 216 3 queC 7-cyano-7-deazaguanine synthase Sulfurovum sp. (strain NBC37-1)
A8EZR4 2.87e-33 122 33 7 222 3 queC 7-cyano-7-deazaguanine synthase Rickettsia canadensis (strain McKiel)
Q3IKE8 3.11e-33 122 34 6 207 3 queC 7-cyano-7-deazaguanine synthase Pseudoalteromonas translucida (strain TAC 125)
Q1RJ87 3.27e-33 122 33 7 221 3 queC 7-cyano-7-deazaguanine synthase Rickettsia bellii (strain RML369-C)
A8GVR7 3.27e-33 122 33 7 221 3 queC 7-cyano-7-deazaguanine synthase Rickettsia bellii (strain OSU 85-389)
Q2J7K8 3.76e-33 122 38 7 215 3 queC 7-cyano-7-deazaguanine synthase Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
Q0AJ94 4.11e-33 122 35 6 217 3 queC 7-cyano-7-deazaguanine synthase Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A4SVH9 4.32e-33 122 35 7 218 3 queC 7-cyano-7-deazaguanine synthase Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A8G7J6 4.59e-33 122 32 7 225 3 queC 7-cyano-7-deazaguanine synthase Prochlorococcus marinus (strain MIT 9215)
Q3SGT8 4.94e-33 122 40 8 225 3 queC 7-cyano-7-deazaguanine synthase Thiobacillus denitrificans (strain ATCC 25259)
Q114E1 5.7e-33 122 34 5 212 3 queC 7-cyano-7-deazaguanine synthase Trichodesmium erythraeum (strain IMS101)
A8GTC6 1.06e-32 121 34 6 214 3 queC 7-cyano-7-deazaguanine synthase Rickettsia rickettsii (strain Sheila Smith)
B0BUW5 1.06e-32 121 34 6 214 3 queC 7-cyano-7-deazaguanine synthase Rickettsia rickettsii (strain Iowa)
Q5H288 1.84e-32 120 38 7 217 3 queC 7-cyano-7-deazaguanine synthase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2STI7 1.84e-32 120 38 7 217 3 queC 7-cyano-7-deazaguanine synthase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P553 1.84e-32 120 38 7 217 3 queC 7-cyano-7-deazaguanine synthase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
A1TWU4 1.88e-32 120 38 7 201 3 queC 7-cyano-7-deazaguanine synthase Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
C3PLH1 2.63e-32 120 33 8 235 3 queC 7-cyano-7-deazaguanine synthase Rickettsia africae (strain ESF-5)
C1F844 2.7e-32 120 36 7 217 3 queC 7-cyano-7-deazaguanine synthase Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
Q3BQG4 2.71e-32 120 38 7 217 3 queC 7-cyano-7-deazaguanine synthase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
A8F2I5 2.81e-32 120 34 6 214 3 queC 7-cyano-7-deazaguanine synthase Rickettsia massiliae (strain Mtu5)
Q92GQ2 2.93e-32 120 34 6 214 3 queC 7-cyano-7-deazaguanine synthase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q7V9H8 3.14e-32 120 35 8 222 3 queC 7-cyano-7-deazaguanine synthase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q1GTF3 3.89e-32 119 38 10 224 3 queC1 7-cyano-7-deazaguanine synthase 1 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q47ZY2 9.36e-32 118 35 6 208 3 queC2 7-cyano-7-deazaguanine synthase 2 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
A2BZ78 1.01e-31 118 33 7 221 3 queC 7-cyano-7-deazaguanine synthase Prochlorococcus marinus (strain MIT 9515)
C4K2L7 1.15e-31 118 33 6 214 3 queC 7-cyano-7-deazaguanine synthase Rickettsia peacockii (strain Rustic)
C0QST3 1.34e-31 118 35 6 215 3 queC 7-cyano-7-deazaguanine synthase Persephonella marina (strain DSM 14350 / EX-H1)
B2V5L9 1.42e-31 118 33 6 219 3 queC 7-cyano-7-deazaguanine synthase Sulfurihydrogenibium sp. (strain YO3AOP1)
Q2G3K1 1.59e-31 118 35 7 215 3 queC 7-cyano-7-deazaguanine synthase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q2W000 1.61e-31 118 35 6 225 3 queC 7-cyano-7-deazaguanine synthase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
A0RM81 2.01e-31 117 35 7 223 3 queC 7-cyano-7-deazaguanine synthase Campylobacter fetus subsp. fetus (strain 82-40)
Q2RSY8 2.1e-31 118 34 7 219 3 queC 7-cyano-7-deazaguanine synthase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B9MMB0 2.74e-31 117 35 4 205 3 queC 7-cyano-7-deazaguanine synthase Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
A5ULR3 7.56e-31 116 32 8 224 3 queC 7-cyano-7-deazaguanine synthase Methanobrevibacter smithii (strain ATCC 35061 / DSM 861 / OCM 144 / PS)
C1DRE9 7.97e-31 116 36 6 216 3 queC 7-cyano-7-deazaguanine synthase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q82XN5 1.19e-30 115 34 7 223 3 queC 7-cyano-7-deazaguanine synthase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
O67003 3.26e-30 114 32 6 217 3 queC 7-cyano-7-deazaguanine synthase Aquifex aeolicus (strain VF5)
Q3MAK6 8.39e-30 114 35 6 213 3 queC 7-cyano-7-deazaguanine synthase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q9ZCM9 9.04e-30 113 32 5 215 3 queC 7-cyano-7-deazaguanine synthase Rickettsia prowazekii (strain Madrid E)
Q8YM45 1.15e-29 113 35 6 213 3 queC 7-cyano-7-deazaguanine synthase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q1QVW9 1.52e-29 114 34 4 205 3 queC 7-cyano-7-deazaguanine synthase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A6URL5 2.66e-29 112 32 8 224 3 queC 7-cyano-7-deazaguanine synthase Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
B7K7J4 4.21e-29 112 34 5 214 3 queC 7-cyano-7-deazaguanine synthase Gloeothece citriformis (strain PCC 7424)
Q3AGF3 4.64e-29 112 33 6 215 3 queC 7-cyano-7-deazaguanine synthase Synechococcus sp. (strain CC9605)
A3CXN3 5.15e-29 111 33 6 218 3 queC 7-cyano-7-deazaguanine synthase Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1)
Q3AUG1 5.32e-29 111 34 5 214 3 queC 7-cyano-7-deazaguanine synthase Synechococcus sp. (strain CC9902)
Q5N5K7 7.34e-29 111 34 5 220 3 queC 7-cyano-7-deazaguanine synthase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31NK6 7.34e-29 111 34 5 220 3 queC 7-cyano-7-deazaguanine synthase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
Q8DI59 9.51e-29 111 34 5 213 3 queC 7-cyano-7-deazaguanine synthase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
A5V652 1.77e-28 110 34 8 223 3 queC 7-cyano-7-deazaguanine synthase Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q55468 2.44e-28 110 35 7 218 3 queC 7-cyano-7-deazaguanine synthase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q0I671 3.07e-28 109 33 6 212 3 queC 7-cyano-7-deazaguanine synthase Synechococcus sp. (strain CC9311)
O29807 4.67e-28 109 36 10 219 3 queC 7-cyano-7-deazaguanine synthase Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
Q8KF00 7.75e-28 108 33 5 214 3 queC 7-cyano-7-deazaguanine synthase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q7U3K1 1.16e-27 108 33 6 215 3 queC 7-cyano-7-deazaguanine synthase Parasynechococcus marenigrum (strain WH8102)
O57836 1.26e-27 108 31 5 242 3 queC 7-cyano-7-deazaguanine synthase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
B8HQ99 1.4e-27 108 32 5 216 3 queC 7-cyano-7-deazaguanine synthase Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Q2FS65 1.46e-27 107 33 6 210 3 queC 7-cyano-7-deazaguanine synthase Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1)
Q30RN3 3.78e-27 106 32 6 215 3 queC 7-cyano-7-deazaguanine synthase Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q1IHK6 3.79e-27 107 35 5 214 3 queC 7-cyano-7-deazaguanine synthase Koribacter versatilis (strain Ellin345)
A2C5G1 3.83e-27 107 32 6 214 3 queC 7-cyano-7-deazaguanine synthase Prochlorococcus marinus (strain NATL1A)
Q46I95 4.63e-27 106 32 7 214 3 queC 7-cyano-7-deazaguanine synthase Prochlorococcus marinus (strain NATL2A)
Q6ARX9 7.29e-27 105 32 5 216 3 queC 7-cyano-7-deazaguanine synthase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
B8GJL3 8.4e-27 105 32 5 212 3 queC 7-cyano-7-deazaguanine synthase Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c)
Q7V3W6 1.03e-26 105 34 8 213 3 queC 7-cyano-7-deazaguanine synthase Prochlorococcus marinus (strain MIT 9313)
Q6M0P3 1.06e-26 105 32 9 218 3 queC 7-cyano-7-deazaguanine synthase Methanococcus maripaludis (strain DSM 14266 / JCM 13030 / NBRC 101832 / S2 / LL)
A4FZY3 2.11e-26 105 32 9 221 3 queC 7-cyano-7-deazaguanine synthase Methanococcus maripaludis (strain C5 / ATCC BAA-1333)
B3ENV8 2.25e-26 104 34 6 213 3 queC 7-cyano-7-deazaguanine synthase Chlorobium phaeobacteroides (strain BS1)
A6VIL3 2.42e-26 105 32 9 221 3 queC 7-cyano-7-deazaguanine synthase Methanococcus maripaludis (strain C7 / ATCC BAA-1331)
B0JIA6 2.92e-26 104 34 7 216 3 queC 7-cyano-7-deazaguanine synthase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
A9A873 3.22e-26 104 31 9 221 3 queC 7-cyano-7-deazaguanine synthase Methanococcus maripaludis (strain C6 / ATCC BAA-1332)
A2CDY7 3.22e-26 104 34 8 213 3 queC 7-cyano-7-deazaguanine synthase Prochlorococcus marinus (strain MIT 9303)
A6UV33 7.58e-26 103 28 5 221 3 queC 7-cyano-7-deazaguanine synthase Methanococcus aeolicus (strain ATCC BAA-1280 / DSM 17508 / OCM 812 / Nankai-3)
B3QPB3 7.12e-25 100 32 5 214 3 queC 7-cyano-7-deazaguanine synthase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q2IUE0 1.01e-24 100 32 4 210 3 queC2 7-cyano-7-deazaguanine synthase 2 Rhodopseudomonas palustris (strain HaA2)
Q3AR02 1.27e-24 100 30 5 213 3 queC 7-cyano-7-deazaguanine synthase Chlorobium chlorochromatii (strain CaD3)
Q5V0E6 2.33e-24 99 32 6 209 3 queC 7-cyano-7-deazaguanine synthase Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809)
A5GWT8 3.34e-24 99 33 7 209 3 queC 7-cyano-7-deazaguanine synthase Synechococcus sp. (strain RCC307)
Q5JHU5 4.2e-24 99 29 5 242 3 queC 7-cyano-7-deazaguanine synthase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q1GEY7 4.96e-24 99 34 6 212 3 queC 7-cyano-7-deazaguanine synthase Ruegeria sp. (strain TM1040)
Q3B5F4 6.24e-24 98 31 5 208 3 queC 7-cyano-7-deazaguanine synthase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
A2STX4 9.17e-24 97 30 5 210 3 queC 7-cyano-7-deazaguanine synthase Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z)
Q9V2I3 1.02e-23 98 29 8 244 3 queC 7-cyano-7-deazaguanine synthase Pyrococcus abyssi (strain GE5 / Orsay)
B4S6H3 1.22e-23 97 33 5 208 3 queC 7-cyano-7-deazaguanine synthase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
A4SDQ0 1.26e-23 97 30 5 213 3 queC 7-cyano-7-deazaguanine synthase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
O27180 1.73e-23 97 30 7 215 3 queC 7-cyano-7-deazaguanine synthase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q58742 8.27e-23 95 31 7 219 3 queC 7-cyano-7-deazaguanine synthase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Q8U4N3 1.21e-22 95 30 8 244 3 queC 7-cyano-7-deazaguanine synthase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
A1BHS4 2.19e-22 94 30 5 213 3 queC 7-cyano-7-deazaguanine synthase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
B3EGF5 9.61e-22 92 30 5 213 3 queC 7-cyano-7-deazaguanine synthase Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q12WI3 1.22e-21 92 27 5 219 3 queC 7-cyano-7-deazaguanine synthase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
Q2NF51 1.9e-21 92 29 7 216 3 queC 7-cyano-7-deazaguanine synthase Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3)
Q6W2G5 1.9e-21 92 29 5 211 3 queC 7-cyano-7-deazaguanine synthase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
Q9HHN8 2.15e-21 91 32 5 226 3 queC 7-cyano-7-deazaguanine synthase Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1)
B0R9W5 2.15e-21 91 32 5 226 3 queC 7-cyano-7-deazaguanine synthase Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Q3ADI5 4.3e-21 90 30 8 217 3 queC 7-cyano-7-deazaguanine synthase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
B3Q0Y0 4.69e-20 88 32 7 212 3 queC 7-cyano-7-deazaguanine synthase Rhizobium etli (strain CIAT 652)
Q1MBE0 7.81e-20 87 31 7 212 3 queC 7-cyano-7-deazaguanine synthase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q2K3X0 9.61e-20 87 32 7 212 3 queC 7-cyano-7-deazaguanine synthase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
A1B9Q5 1.08e-19 87 30 5 211 3 queC 7-cyano-7-deazaguanine synthase Paracoccus denitrificans (strain Pd 1222)
Q8UAM7 1.55e-19 87 31 5 211 3 queC 7-cyano-7-deazaguanine synthase Agrobacterium fabrum (strain C58 / ATCC 33970)
B3QS09 1.64e-19 86 30 7 214 3 queC 7-cyano-7-deazaguanine synthase Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
B5ZR38 3.04e-19 86 32 7 212 3 queC 7-cyano-7-deazaguanine synthase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
A5GPN0 3.38e-19 85 32 7 212 3 queC 7-cyano-7-deazaguanine synthase Synechococcus sp. (strain WH7803)
Q92UN9 9.28e-19 85 29 5 211 3 queC 7-cyano-7-deazaguanine synthase Rhizobium meliloti (strain 1021)
Q98AZ0 1.19e-18 84 32 5 211 3 queC1 7-cyano-7-deazaguanine synthase 1 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q46G70 4.62e-18 83 27 7 217 3 queC 7-cyano-7-deazaguanine synthase Methanosarcina barkeri (strain Fusaro / DSM 804)
A6WXM7 4.95e-18 82 30 5 211 3 queC 7-cyano-7-deazaguanine synthase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
B9JS46 5.22e-18 82 29 5 211 3 queC 7-cyano-7-deazaguanine synthase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q5LM13 5.87e-18 82 29 5 211 3 queC 7-cyano-7-deazaguanine synthase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
B9JLH9 7.09e-18 82 29 5 211 3 queC 7-cyano-7-deazaguanine synthase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
B1I3W2 9.27e-18 82 32 8 214 3 queC 7-cyano-7-deazaguanine synthase Desulforudis audaxviator (strain MP104C)
Q8FYB3 1.42e-17 81 29 6 212 3 queC 7-cyano-7-deazaguanine synthase Brucella suis biovar 1 (strain 1330)
A9M959 1.42e-17 81 29 6 212 3 queC 7-cyano-7-deazaguanine synthase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
B0CIX5 1.49e-17 81 29 6 212 3 queC 7-cyano-7-deazaguanine synthase Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VSU2 1.49e-17 81 29 6 212 3 queC 7-cyano-7-deazaguanine synthase Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q8YJI8 1.49e-17 81 29 6 212 3 queC 7-cyano-7-deazaguanine synthase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RFL5 1.49e-17 81 29 6 212 3 queC 7-cyano-7-deazaguanine synthase Brucella melitensis biotype 2 (strain ATCC 23457)

  • Number of RefSeq hits:

General

Source Morganella morganii S2
Locus tag EHELCC_18510
Feature type CDS
Gene queC
Product 7-cyano-7-deazaguanine synthase QueC
Location 20206 - 20904 (strand: -1)
Length 699 (nucleotides) / 232 (amino acids)
In genomic island -

Contig

Accession ZDB_237
Length 30268 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2155
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06508 Queuosine biosynthesis protein QueC

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0603 Translation, ribosomal structure and biogenesis (J) J 7-cyano-7-deazaguanine synthase (queuosine biosynthesis)

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K06920 7-cyano-7-deazaguanine synthase [EC:6.3.4.20] Folate biosynthesis
Metabolic pathways
PreQ1 biosynthesis, GTP => 7-Aminomethyl-7-deazaguanine

Protein Sequence

MKRAVVVFSGGQDSTTCLIQALRNYDEVHCVTFDYGQRHSQEIDVARKLSLKLGAAAHKVLDVSLLNELAVSSLTRDNIPVPGFSESEQSDIPNTFVPGRNILFLTLTAIYAYQVNAEAIITGVCETDFSGYPDCRDEFVKALNKAVNAGLARDIRFETPLMWLDKAQTWALADYYGQLDTVRTETLTCYNGIQGDGCGECAACHLRRNGLDSYLADRSAVMAAMKKITGLH

Flanking regions ( +/- flanking 50bp)

GTGATGCAGCCGTTACCATAAACCTTATCTTTTTATAATGAGGTTTACCGATGAAACGTGCTGTGGTCGTATTCAGTGGCGGGCAGGACTCCACAACCTGCCTGATTCAGGCACTACGCAACTATGATGAAGTGCATTGTGTGACGTTTGATTACGGACAGCGCCACAGTCAGGAAATAGACGTTGCCCGTAAACTCAGCCTGAAACTGGGTGCAGCGGCACATAAGGTGCTGGATGTCTCTCTGCTGAATGAACTGGCGGTCAGCAGCCTGACCCGTGATAACATCCCGGTGCCCGGGTTCAGTGAAAGTGAACAAAGCGATATCCCGAATACCTTTGTCCCGGGCCGTAATATCCTGTTTCTCACCCTGACGGCGATTTATGCTTATCAGGTCAATGCGGAAGCGATTATCACCGGTGTCTGTGAAACCGATTTTTCCGGTTATCCGGATTGCCGGGACGAGTTTGTCAAAGCACTGAACAAAGCCGTCAACGCCGGTCTTGCCCGTGATATCCGCTTTGAAACCCCGCTGATGTGGCTGGATAAAGCACAGACCTGGGCGCTGGCTGATTATTACGGACAACTGGATACCGTCCGCACAGAAACACTGACCTGCTATAACGGTATTCAGGGGGATGGCTGCGGGGAATGCGCCGCCTGCCATCTGCGCCGCAACGGACTGGACAGCTATCTTGCTGATCGCAGTGCTGTTATGGCCGCCATGAAAAAAATTACCGGCCTGCATTAAGTGTCTGTTACGCCCGGCAACCCGCCGGGCGCTTTTCTGTCCTGATGGTG