Homologs in group_2147

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15860 FBDBKF_15860 52.0 Morganella morganii S1 bolA transcriptional regulator BolA
EHELCC_18460 EHELCC_18460 52.0 Morganella morganii S2 bolA transcriptional regulator BolA
NLDBIP_17295 NLDBIP_17295 52.0 Morganella morganii S4 bolA transcriptional regulator BolA
LHKJJB_17365 LHKJJB_17365 52.0 Morganella morganii S3 bolA transcriptional regulator BolA
HKOGLL_17030 HKOGLL_17030 52.0 Morganella morganii S5 bolA transcriptional regulator BolA
F4V73_RS16450 F4V73_RS16450 52.9 Morganella psychrotolerans bolA transcriptional regulator BolA

Distribution of the homologs in the orthogroup group_2147

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2147

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ABE4 1.6e-40 132 60 0 100 3 bolA DNA-binding transcriptional regulator BolA Shigella flexneri
P0ABE2 1.6e-40 132 60 0 100 1 bolA DNA-binding transcriptional regulator BolA Escherichia coli (strain K12)
P0ABE3 1.6e-40 132 60 0 100 3 bolA DNA-binding transcriptional regulator BolA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q56585 1.03e-36 122 57 0 101 3 bolA DNA-binding transcriptional regulator BolA Vibrio alginolyticus
Q9KPS0 2.22e-35 119 56 0 103 3 bolA DNA-binding transcriptional regulator BolA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P43780 2.15e-25 94 53 0 86 3 bolA DNA-binding transcriptional regulator BolA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P91375 2.95e-23 89 47 1 95 3 K11H12.1 Putative bolA-like protein K11H12.1 Caenorhabditis elegans
Q9D8S9 2.24e-21 85 43 1 102 1 Bola1 BolA-like protein 1 Mus musculus
Q3T138 5.18e-20 81 41 2 105 2 BOLA1 BolA-like protein 1 Bos taurus
Q86KD0 7.59e-20 80 39 2 105 3 DDB_G0274169 BolA-like protein DDB_G0274169 Dictyostelium discoideum
Q9Y3E2 2.54e-19 79 40 2 105 1 BOLA1 BolA-like protein 1 Homo sapiens
Q5RCE5 2.95e-19 79 40 2 105 2 BOLA1 BolA-like protein 1 Pongo abelii
P57545 1.63e-14 66 27 0 97 3 BU473 Uncharacterized protein BU473 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q8K992 3.7e-14 65 31 1 99 3 BUsg_457 Uncharacterized protein BUsg_457 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q89AA2 6.6e-14 65 32 2 102 3 bbp_418 Uncharacterized protein bbp_418 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P29943 2.45e-13 63 45 1 80 3 None Uncharacterized protein in cobS 5'region Sinorhizobium sp.
Q12238 4.84e-07 47 38 1 65 2 uvi31 UV-induced protein uvi31 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q682I1 1.33e-06 47 39 1 84 1 BOLA1 Protein BOLA1, chloroplastic Arabidopsis thaliana
Q84W65 1.57e-06 48 37 1 86 1 SUFE1 SufE-like protein 1, chloroplastic/mitochondrial Arabidopsis thaliana
Q3E793 2.17e-06 45 36 2 75 1 BOL1 BolA-like protein 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q9FIC3 5.78e-06 44 31 3 85 1 BOLA2 Protein BOLA2 Arabidopsis thaliana
P0A9W8 2.17e-05 42 35 1 54 3 ibaG Acid stress protein IbaG Shigella flexneri
P0A9W6 2.17e-05 42 35 1 54 1 ibaG Acid stress protein IbaG Escherichia coli (strain K12)
P0A9W7 2.17e-05 42 35 1 54 3 ibaG Acid stress protein IbaG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q89AF0 2.42e-05 42 28 1 57 3 bbp_348 Uncharacterized protein bbp_348 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
P73055 4.78e-05 42 39 1 53 3 ssr3122 Uncharacterized protein ssr3122 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
O14280 0.000125 40 31 1 63 3 SPAC8C9.11 Uncharacterized bolA-like protein C8C9.11 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P45026 0.000163 40 32 2 62 1 HI_1082 Uncharacterized protein HI_1082 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q8K9G5 0.000381 39 25 1 54 3 BUsg_372 Uncharacterized protein BUsg_372 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS00545
Feature type CDS
Gene bolA
Product transcriptional regulator BolA
Location 140805 - 141119 (strand: 1)
Length 315 (nucleotides) / 104 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2147
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01722 BolA-like protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0271 Transcription (K)
Signal transduction mechanisms (T)
KT DNA-binding global transcriptional regulator BolA, affects cell shape, cell division and biofilm formation

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05527 BolA family transcriptional regulator, general stress-responsive regulator - -

Protein Sequence

MIRDDIENKLISRFSPHFLQVINESHRHNVPAGSESHFKVVIVSDLFNDKRSVSRHRDVYQTLSHELDNGVHALALHTFTLSEWDEQQDKALHSPGCRGGSQQD

Flanking regions ( +/- flanking 50bp)

TTAACTAACAGATAACTTCTTTTTTTGATTGTTATGTTATAAGGACTGAGATGATCCGTGATGATATTGAGAATAAGCTGATTTCACGCTTTTCTCCCCATTTTTTGCAAGTCATTAACGAAAGCCATCGTCATAATGTACCTGCAGGCTCGGAGAGCCATTTTAAAGTCGTTATTGTGAGTGACTTATTTAATGATAAACGCAGTGTGTCACGTCATCGTGATGTTTATCAAACGTTATCTCATGAATTAGATAATGGCGTTCATGCTTTAGCTCTGCACACTTTTACCTTGAGCGAGTGGGATGAACAACAAGATAAAGCATTACACTCTCCAGGATGTCGTGGTGGAAGCCAACAAGATTAATAAGAAGATTGTTAATCGTGAGTAAATGATGACTAAGATGCGTATTTTTT