Homologs in group_2147

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15860 FBDBKF_15860 100.0 Morganella morganii S1 bolA transcriptional regulator BolA
EHELCC_18460 EHELCC_18460 100.0 Morganella morganii S2 bolA transcriptional regulator BolA
LHKJJB_17365 LHKJJB_17365 100.0 Morganella morganii S3 bolA transcriptional regulator BolA
HKOGLL_17030 HKOGLL_17030 100.0 Morganella morganii S5 bolA transcriptional regulator BolA
F4V73_RS16450 F4V73_RS16450 81.7 Morganella psychrotolerans bolA transcriptional regulator BolA
PMI_RS00545 PMI_RS00545 52.0 Proteus mirabilis HI4320 bolA transcriptional regulator BolA

Distribution of the homologs in the orthogroup group_2147

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2147

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q56585 3.9e-37 124 55 0 101 3 bolA DNA-binding transcriptional regulator BolA Vibrio alginolyticus
Q9KPS0 1.66e-35 120 54 0 102 3 bolA DNA-binding transcriptional regulator BolA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P0ABE4 1.88e-35 120 56 0 101 3 bolA DNA-binding transcriptional regulator BolA Shigella flexneri
P0ABE2 1.88e-35 120 56 0 101 1 bolA DNA-binding transcriptional regulator BolA Escherichia coli (strain K12)
P0ABE3 1.88e-35 120 56 0 101 3 bolA DNA-binding transcriptional regulator BolA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9D8S9 2.6e-26 97 50 1 97 1 Bola1 BolA-like protein 1 Mus musculus
Q5RCE5 1.07e-25 96 49 1 97 2 BOLA1 BolA-like protein 1 Pongo abelii
Q3T138 6.32e-25 94 48 1 97 2 BOLA1 BolA-like protein 1 Bos taurus
Q9Y3E2 6.67e-25 94 48 1 97 1 BOLA1 BolA-like protein 1 Homo sapiens
P43780 6.41e-23 88 44 0 89 3 bolA DNA-binding transcriptional regulator BolA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q86KD0 1.08e-19 80 38 3 105 3 DDB_G0274169 BolA-like protein DDB_G0274169 Dictyostelium discoideum
P91375 1.63e-19 79 44 1 95 3 K11H12.1 Putative bolA-like protein K11H12.1 Caenorhabditis elegans
Q12238 6.07e-17 72 44 2 89 2 uvi31 UV-induced protein uvi31 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P29943 6.55e-14 65 42 1 87 3 None Uncharacterized protein in cobS 5'region Sinorhizobium sp.
Q682I1 1.45e-12 63 43 1 85 1 BOLA1 Protein BOLA1, chloroplastic Arabidopsis thaliana
Q89AA2 2.8e-12 61 27 2 102 3 bbp_418 Uncharacterized protein bbp_418 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q8K992 3.19e-12 61 26 1 99 3 BUsg_457 Uncharacterized protein BUsg_457 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57545 5.77e-12 60 22 0 94 3 BU473 Uncharacterized protein BU473 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q84W65 1.44e-11 62 42 1 87 1 SUFE1 SufE-like protein 1, chloroplastic/mitochondrial Arabidopsis thaliana
Q3E793 1.27e-10 57 40 2 74 1 BOL1 BolA-like protein 1 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P73055 1.07e-07 48 45 1 53 3 ssr3122 Uncharacterized protein ssr3122 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q9FIC3 4.85e-07 47 31 3 86 1 BOLA2 Protein BOLA2 Arabidopsis thaliana
P0A9W8 3.96e-06 44 37 1 54 3 ibaG Acid stress protein IbaG Shigella flexneri
P0A9W6 3.96e-06 44 37 1 54 1 ibaG Acid stress protein IbaG Escherichia coli (strain K12)
P0A9W7 3.96e-06 44 37 1 54 3 ibaG Acid stress protein IbaG Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q9H3K6 1.13e-05 43 36 3 79 1 BOLA2 BolA-like protein 2 Homo sapiens
Q8BGS2 2.21e-05 42 34 3 83 1 Bola2 BolA-like protein 2 Mus musculus
P57465 3.08e-05 42 27 1 58 3 BU385 Uncharacterized protein BU385 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
O14280 3.46e-05 42 27 2 86 3 SPAC8C9.11 Uncharacterized bolA-like protein C8C9.11 Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q8K9G5 5.15e-05 41 26 1 53 3 BUsg_372 Uncharacterized protein BUsg_372 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P45026 0.000171 40 32 1 58 1 HI_1082 Uncharacterized protein HI_1082 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9USK1 0.000193 40 28 3 92 3 SPCC4B3.11c Uncharacterized bolA-like protein C4B3.11c Schizosaccharomyces pombe (strain 972 / ATCC 24843)
P33989 0.000404 39 33 1 57 3 None Uncharacterized protein in rpoN-murA intergenic region Acinetobacter guillouiae
P53082 0.000426 40 28 2 85 1 BOL2 BolA-like protein 2 Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_17295
Feature type CDS
Gene bolA
Product transcriptional regulator BolA
Location 9921 - 10250 (strand: 1)
Length 330 (nucleotides) / 109 (amino acids)
In genomic island -

Contig

Accession ZDB_536
Length 56187 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2147
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01722 BolA-like protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0271 Transcription (K)
Signal transduction mechanisms (T)
KT DNA-binding global transcriptional regulator BolA, affects cell shape, cell division and biofilm formation

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K05527 BolA family transcriptional regulator, general stress-responsive regulator - -

Protein Sequence

MSASFPAVMQQRIEEKLNHALAPHYISVVNESSQHNVPAGSETHFKVVVVSETFAGMRPVARHRHMYTLLADELAGGVHALALHTYTPDEWNHSQGGVNPSPRCHGGGK

Flanking regions ( +/- flanking 50bp)

TCACTACACTGAGCTTTCTCTGAAAGCCAGTATTGACCGGAAGGATAGTTATGTCGGCATCATTTCCTGCTGTAATGCAGCAGCGTATTGAAGAAAAACTGAATCACGCGCTTGCGCCTCATTATATCAGTGTGGTGAATGAGAGCAGCCAGCACAATGTTCCGGCGGGATCGGAAACTCATTTTAAGGTGGTGGTGGTCAGTGAGACCTTTGCGGGCATGCGCCCGGTGGCACGTCACCGTCATATGTACACGCTGCTGGCTGATGAGCTGGCTGGCGGGGTTCACGCTCTGGCGCTGCATACTTATACCCCGGATGAGTGGAATCACAGTCAGGGCGGGGTGAATCCGTCCCCGCGTTGTCATGGTGGCGGAAAGTAAGCCGCTGTTTGAGTGAAAAAGCAGCGCACAGCACAAAATTTAACAGAAAA