Homologs in group_2102

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15825 FBDBKF_15825 82.7 Morganella morganii S1 cyoD cytochrome o ubiquinol oxidase subunit IV
EHELCC_18425 EHELCC_18425 82.7 Morganella morganii S2 cyoD cytochrome o ubiquinol oxidase subunit IV
NLDBIP_17260 NLDBIP_17260 82.7 Morganella morganii S4 cyoD cytochrome o ubiquinol oxidase subunit IV
LHKJJB_17400 LHKJJB_17400 82.7 Morganella morganii S3 cyoD cytochrome o ubiquinol oxidase subunit IV
HKOGLL_16995 HKOGLL_16995 82.7 Morganella morganii S5 cyoD cytochrome o ubiquinol oxidase subunit IV
F4V73_RS16485 F4V73_RS16485 81.8 Morganella psychrotolerans - cytochrome o ubiquinol oxidase subunit IV

Distribution of the homologs in the orthogroup group_2102

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2102

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ABJ8 1.18e-47 150 68 1 109 3 cyoD Cytochrome bo(3) ubiquinol oxidase subunit 4 Shigella flexneri
P0ABJ6 1.18e-47 150 68 1 109 1 cyoD Cytochrome bo(3) ubiquinol oxidase subunit 4 Escherichia coli (strain K12)
P0ABJ7 1.18e-47 150 68 1 109 3 cyoD Cytochrome bo(3) ubiquinol oxidase subunit 4 Escherichia coli O157:H7
Q9WWR4 1.37e-28 102 48 0 108 3 cyoD Cytochrome bo(3) ubiquinol oxidase subunit 4 Pseudomonas putida
Q9I424 3.58e-27 99 54 0 108 3 cyoD Cytochrome bo(3) ubiquinol oxidase subunit 4 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8K996 6.61e-15 67 40 0 91 3 cyoD Cytochrome bo(3) ubiquinol oxidase subunit 4 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57541 3.63e-13 63 45 0 96 3 cyoD Cytochrome bo(3) ubiquinol oxidase subunit 4 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P34959 1.27e-09 54 32 0 83 1 qoxD Quinol oxidase subunit 4 Bacillus subtilis (strain 168)
E0TW64 5.95e-09 53 31 0 83 1 qoxD Quinol oxidase subunit 4 Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23)
Q49WI1 1.5e-06 46 27 0 83 3 qoxD Probable quinol oxidase subunit 4 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q89AA6 1.59e-06 46 28 0 75 3 cyoD Cytochrome bo(3) ubiquinol oxidase subunit 4 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q7A184 5.5e-06 44 28 0 80 3 qoxD Probable quinol oxidase subunit 4 Staphylococcus aureus (strain MW2)
Q6GAF5 5.5e-06 44 28 0 80 3 qoxD Probable quinol oxidase subunit 4 Staphylococcus aureus (strain MSSA476)
Q7A6A1 5.5e-06 44 28 0 80 3 qoxD Probable quinol oxidase subunit 4 Staphylococcus aureus (strain N315)
Q99V39 5.5e-06 44 28 0 80 3 qoxD Probable quinol oxidase subunit 4 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HH26 5.5e-06 44 28 0 80 3 qoxD Probable quinol oxidase subunit 4 Staphylococcus aureus (strain COL)
Q2YX17 5.5e-06 44 28 0 80 3 qoxD Probable quinol oxidase subunit 4 Staphylococcus aureus (strain bovine RF122 / ET3-1)
Q2FZK2 5.5e-06 44 28 0 80 3 qoxD Probable quinol oxidase subunit 4 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FI20 5.5e-06 44 28 0 80 3 qoxD Probable quinol oxidase subunit 4 Staphylococcus aureus (strain USA300)
Q6GI26 8.51e-06 44 27 0 80 3 qoxD Probable quinol oxidase subunit 4 Staphylococcus aureus (strain MRSA252)
Q8CPP9 1.66e-05 43 25 0 83 3 qoxD Probable quinol oxidase subunit 4 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HQB2 1.66e-05 43 25 0 83 3 qoxD Probable quinol oxidase subunit 4 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q4L562 0.000121 41 25 0 83 3 qoxD Probable quinol oxidase subunit 4 Staphylococcus haemolyticus (strain JCSC1435)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS00505
Feature type CDS
Gene -
Product cytochrome o ubiquinol oxidase subunit IV
Location 131351 - 131683 (strand: -1)
Length 333 (nucleotides) / 110 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2102
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF03626 Prokaryotic Cytochrome C oxidase subunit IV

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3125 Energy production and conversion (C) C Heme/copper-type cytochrome/quinol oxidase, subunit 4

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02300 cytochrome o ubiquinol oxidase subunit IV Oxidative phosphorylation
Metabolic pathways		 Cytochrome o ubiquinol oxidase

Protein Sequence

MSHPNTSPSGASHGSMKSYLIGFILSVILTVIPFWMVMEGTATTSTILWTVVGMAVVQIVVHLVCFLHMNTSSEERWNVIAFLFTLLIIGIVVIGSLWIMYNLNINMMMD

Flanking regions ( +/- flanking 50bp)

GTTGTCTGGATCTGTGTGTTCACCGTAGTTTATCTGATGGGAGCGATGTAATGAGTCATCCAAATACTTCTCCTTCAGGCGCAAGCCACGGCAGCATGAAGTCCTATCTGATTGGCTTTATTCTGTCCGTTATCCTCACCGTGATCCCATTTTGGATGGTGATGGAAGGAACAGCTACAACCTCAACTATCTTATGGACAGTCGTTGGTATGGCCGTCGTACAGATTGTTGTTCATTTAGTCTGTTTCTTACATATGAACACGTCCTCAGAAGAGCGCTGGAACGTTATCGCATTCCTATTCACCTTGTTGATTATCGGCATTGTTGTGATTGGCTCACTGTGGATTATGTACAACCTGAACATCAATATGATGATGGATTAAGAGTTGTCGCTATGATTAAGCAATACCTACAAGTCACCAAACCAGGAATT