Homologs in group_164

Help

9 homologs were identified in 7 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_15395 FBDBKF_15395 74.0 Morganella morganii S1 rbsK ribokinase
EHELCC_15755 EHELCC_15755 74.0 Morganella morganii S2 rbsK ribokinase
NLDBIP_16615 NLDBIP_16615 74.0 Morganella morganii S4 rbsK ribokinase
LHKJJB_16190 LHKJJB_16190 74.0 Morganella morganii S3 rbsK ribokinase
HKOGLL_15960 HKOGLL_15960 74.0 Morganella morganii S5 rbsK ribokinase
F4V73_RS17750 F4V73_RS17750 75.0 Morganella psychrotolerans rbsK ribokinase
PMI_RS10785 PMI_RS10785 26.5 Proteus mirabilis HI4320 - aminoimidazole riboside kinase
PMI_RS15100 PMI_RS15100 62.7 Proteus mirabilis HI4320 rbsK ribokinase
PMI_RS17465 PMI_RS17465 36.8 Proteus mirabilis HI4320 rbsK ribokinase

Distribution of the homologs in the orthogroup group_164

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_164

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0A9J6 8.96e-126 364 65 0 299 1 rbsK Ribokinase Escherichia coli (strain K12)
P0A9J7 8.96e-126 364 65 0 299 3 rbsK Ribokinase Escherichia coli O157:H7
P44331 9.05e-114 333 56 0 299 3 rbsK Ribokinase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A0A0H2WZY4 1.64e-77 241 43 2 300 1 rbsK Ribokinase Staphylococcus aureus (strain COL)
P83534 3.36e-68 224 40 2 298 1 rbsK/rbiA Bifunctional ribokinase/ribose-5-phosphate isomerase A Fructilactobacillus sanfranciscensis (strain ATCC 27651 / DSM 20451 / JCM 5668 / CCUG 30143 / KCTC 3205 / NCIMB 702811 / NRRL B-3934 / L-12)
P36945 5.8e-66 211 40 3 301 3 rbsK Ribokinase Bacillus subtilis (strain 168)
O60116 4.89e-62 202 40 5 308 3 rbk1 Ribokinase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q9K6K1 6.86e-61 198 40 5 307 3 rbsK Ribokinase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q7CPF5 6.2e-58 191 37 3 303 1 deoK Deoxyribokinase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0DX97 6.2e-58 191 37 3 303 1 deoK Deoxyribokinase Salmonella typhi
Q9H477 3.14e-56 187 38 3 296 1 RBKS Ribokinase Homo sapiens
Q8R1Q9 7.38e-56 186 38 3 296 1 Rbks Ribokinase Mus musculus
Q9CF42 7.62e-56 186 36 5 304 3 rbsK Ribokinase Lactococcus lactis subsp. lactis (strain IL1403)
E9AD19 3.28e-52 177 36 6 309 1 LMJF_27_0420 Ribokinase Leishmania major
A1A6H3 3.08e-47 166 36 5 309 1 RBSK Ribokinase Arabidopsis thaliana
Q54UQ4 2.61e-45 159 32 5 314 3 rbsk Ribokinase Dictyostelium discoideum
P25332 2.2e-29 117 29 10 330 1 RBK1 Ribokinase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
P77493 1.92e-28 114 31 8 279 1 ydjH Uncharacterized sugar kinase YdjH Escherichia coli (strain K12)
P32143 3.88e-23 100 29 6 303 1 yihV Sulfofructose kinase Escherichia coli (strain K12)
Q0JGZ6 1.5e-19 90 27 8 289 1 FRK1 Fructokinase-1 Oryza sativa subsp. japonica
A2WXV8 1.85e-19 90 27 8 289 1 FRK1 Fructokinase-1 Oryza sativa subsp. indica
Q9SID0 4.1e-19 89 27 9 293 2 At2g31390 Probable fructokinase-1 Arabidopsis thaliana
P37829 2.09e-18 87 28 7 279 2 None Fructokinase Solanum tuberosum
Q6XZ79 2.39e-18 87 29 10 287 1 FRK1 Fructokinase-1 Zea mays
Q7XJ81 3.21e-18 86 27 6 294 2 FRK2 Fructokinase-2 Solanum habrochaites
Q9M1B9 8.13e-18 85 27 10 290 2 At3g59480 Probable fructokinase-4 Arabidopsis thaliana
Q42896 8.56e-18 85 27 6 294 2 FRK2 Fructokinase-2 Solanum lycopersicum
Q9LNE3 8.83e-18 85 27 9 290 2 At1g06030 Probable fructokinase-2 Arabidopsis thaliana
Q63B75 1.4e-17 85 26 10 318 3 iolC1 5-dehydro-2-deoxygluconokinase 1 Bacillus cereus (strain ZK / E33L)
Q9LNE4 1.87e-17 84 28 11 294 2 At1g06020 Probable fructokinase-3 Arabidopsis thaliana
Q4V1F7 6.25e-17 83 26 11 319 3 iolC2 5-dehydro-2-deoxygluconokinase 2 Bacillus cereus (strain ZK / E33L)
A9CES5 6.49e-17 83 27 8 272 1 Atu3166 Tagatose kinase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q9FLH8 7.08e-17 83 28 9 297 1 At5g51830 Probable fructokinase-7 Arabidopsis thaliana
Q898F0 1.67e-16 82 25 8 316 3 iolC 5-dehydro-2-deoxygluconokinase Clostridium tetani (strain Massachusetts / E88)
P50845 1.75e-16 82 25 7 283 2 kdgK 2-dehydro-3-deoxygluconokinase Bacillus subtilis (strain 168)
P30235 1.84e-16 81 23 10 297 1 psuK Pseudouridine kinase Escherichia coli (strain K12)
Q6HIK4 2.63e-16 81 26 10 318 3 iolC 5-dehydro-2-deoxygluconokinase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q81QB7 2.82e-16 81 26 10 318 3 iolC 5-dehydro-2-deoxygluconokinase Bacillus anthracis
C3LHY4 2.82e-16 81 26 10 318 3 iolC 5-dehydro-2-deoxygluconokinase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3PAZ0 2.82e-16 81 26 10 318 3 iolC 5-dehydro-2-deoxygluconokinase Bacillus anthracis (strain A0248)
C1EVJ1 3.63e-16 80 26 10 318 3 iolC 5-dehydro-2-deoxygluconokinase Bacillus cereus (strain 03BB102)
A0REB4 3.63e-16 80 26 10 318 3 iolC 5-dehydro-2-deoxygluconokinase Bacillus thuringiensis (strain Al Hakam)
P22824 6.06e-16 80 24 6 290 3 scrK Fructokinase Vibrio alginolyticus
Q5JDG9 6.48e-16 79 25 8 299 1 TK2029 ADP-dependent ribose-1-phosphate kinase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
O29891 6.53e-16 79 26 8 255 3 AF_0356 Uncharacterized sugar kinase AF_0356 Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16)
A4IPB3 7.92e-16 80 25 12 316 3 iolC 5-dehydro-2-deoxygluconokinase Geobacillus thermodenitrificans (strain NG80-2)
Q53W83 1.9e-15 78 23 7 302 1 kdgK 2-dehydro-3-deoxygluconokinase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
O82616 2.2e-15 78 25 8 279 2 At4g10260 Probable fructokinase-5 Arabidopsis thaliana
P33020 9.99e-15 77 25 6 282 3 yeiI Uncharacterized sugar kinase YeiI Escherichia coli (strain K12)
Q5WKY9 1.51e-14 76 25 10 318 3 iolC 5-dehydro-2-deoxygluconokinase Shouchella clausii (strain KSM-K16)
Q96XN9 1.68e-14 75 25 7 283 1 kdgK 2-dehydro-3-deoxygluconokinase Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7)
O34768 1.73e-14 76 25 6 294 3 ydjE Uncharacterized sugar kinase YdjE Bacillus subtilis (strain 168)
F8D4I6 2.6e-14 75 28 11 311 1 Halxa_1682 ATP-dependent ribose-1-phosphate kinase Halopiger xanaduensis (strain DSM 18323 / JCM 14033 / SH-6)
Q8ZKR2 2.94e-14 75 24 6 291 1 STM4066 Aminoimidazole riboside kinase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P42414 3.1e-14 75 25 12 310 1 iolC 5-dehydro-2-deoxygluconokinase Bacillus subtilis (strain 168)
Q9C524 5.32e-14 75 26 9 293 2 At1g66430 Probable fructokinase-6, chloroplastic Arabidopsis thaliana
Q704D0 1.4e-13 73 24 6 281 1 kdgK 2-dehydro-3-deoxygluconokinase Thermoproteus tenax
Q65D02 1.56e-13 73 23 11 312 3 iolC 5-dehydro-2-deoxygluconokinase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
P26420 2e-13 72 27 9 292 1 scrK Fructokinase Klebsiella pneumoniae
Q723S9 6.61e-13 71 24 14 324 3 iolC 5-dehydro-2-deoxygluconokinase Listeria monocytogenes serotype 4b (strain F2365)
C1KZA1 6.61e-13 71 24 14 324 3 iolC 5-dehydro-2-deoxygluconokinase Listeria monocytogenes serotype 4b (strain CLIP80459)
Q8Y9Y2 7.27e-13 71 23 13 322 3 iolC 5-dehydro-2-deoxygluconokinase Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DCT6 1e-12 70 24 14 324 3 iolC 5-dehydro-2-deoxygluconokinase Listeria monocytogenes serotype 4a (strain HCC23)
Q92EQ5 1.57e-12 70 23 13 321 3 iolC 5-dehydro-2-deoxygluconokinase Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P45416 1.68e-12 70 23 9 318 1 kdgK 2-dehydro-3-deoxygluconokinase Dickeya dadantii (strain 3937)
A6M229 2.6e-12 70 25 8 296 3 iolC 5-dehydro-2-deoxygluconokinase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
B2V4J8 3.04e-12 69 23 8 297 3 iolC 5-dehydro-2-deoxygluconokinase Clostridium botulinum (strain Alaska E43 / Type E3)
Q0J8G4 3.93e-12 69 23 6 278 1 FRK2 Fructokinase-2 Oryza sativa subsp. japonica
A2YQL4 3.93e-12 69 23 6 278 1 FRK2 Fructokinase-2 Oryza sativa subsp. indica
P40713 4.23e-12 68 25 6 282 3 cscK Fructokinase Escherichia coli
Q8XP78 1.15e-11 68 25 9 289 3 iolC 5-dehydro-2-deoxygluconokinase Clostridium perfringens (strain 13 / Type A)
Q0TUZ4 1.15e-11 68 25 9 289 3 iolC 5-dehydro-2-deoxygluconokinase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q6XZ78 1.39e-11 67 23 5 278 1 FRK2 Fructokinase-2 Zea mays
A7ZAH9 1.65e-11 67 24 12 304 3 iolC 5-dehydro-2-deoxygluconokinase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q97U29 2.42e-11 67 22 5 297 1 kdgK 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
B2TJ78 4.27e-11 66 23 9 298 3 iolC 5-dehydro-2-deoxygluconokinase Clostridium botulinum (strain Eklund 17B / Type B)
O24767 4.56e-11 65 24 7 294 1 gsk Guanosine-inosine kinase Exiguobacterium acetylicum
D9TT10 4.81e-11 66 23 7 293 1 pfkB ATP-dependent 6-phosphofructokinase Thermoanaerobacterium thermosaccharolyticum (strain ATCC 7956 / DSM 571 / NCIMB 9385 / NCA 3814 / NCTC 13789 / WDCM 00135 / 2032)
Q5KYR3 4.99e-11 66 24 13 321 3 iolC 5-dehydro-2-deoxygluconokinase Geobacillus kaustophilus (strain HTA426)
O27587 4.99e-11 65 24 9 315 3 MTH_1544 Nucleoside kinase Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
Q57849 6.92e-11 65 21 10 308 1 MJ0406 Nucleoside kinase Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
O59128 1.06e-10 65 25 7 285 1 PH1459 Putative sugar kinase PH1459 Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
Q9KAG8 1.61e-10 64 22 12 325 1 iolC 5-dehydro-2-deoxygluconokinase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P37647 2.7e-10 63 21 8 297 1 kdgK 2-dehydro-3-deoxygluconokinase Escherichia coli (strain K12)
A1AV12 4.09e-10 63 25 8 280 3 hldE Bifunctional protein HldE Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
A6Q4Z6 6.5e-10 63 25 11 305 3 hldE Bifunctional protein HldE Nitratiruptor sp. (strain SB155-2)
B3E5M9 7.16e-10 63 24 9 278 3 hldE Bifunctional protein HldE Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q9ZKZ0 7.27e-10 63 28 6 259 3 hldE Bifunctional protein HldE Helicobacter pylori (strain J99 / ATCC 700824)
Q9SX54 7.69e-10 61 32 4 135 5 At1g50390 Putative fructokinase-8 Arabidopsis thaliana
Q6LK43 1.05e-09 62 22 7 289 3 iolC 5-dehydro-2-deoxygluconokinase Photobacterium profundum (strain SS9)
A5EWS4 1.12e-09 62 25 10 313 3 hldE Bifunctional protein HldE Dichelobacter nodosus (strain VCS1703A)
E0J5J4 1.28e-09 61 21 8 297 1 kdgK 2-dehydro-3-deoxygluconokinase Escherichia coli (strain ATCC 9637 / CCM 2024 / DSM 1116 / LMG 11080 / NBRC 13500 / NCIMB 8666 / NRRL B-766 / W)
D4GSE6 1.76e-09 61 24 10 300 1 kdgK1 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
P55262 2.91e-09 60 24 8 253 1 ADK Adenosine kinase Cricetulus griseus
O25529 2.94e-09 61 29 7 260 3 hldE Bifunctional protein HldE Helicobacter pylori (strain ATCC 700392 / 26695)
Q1CT14 3.39e-09 61 27 6 259 3 hldE Bifunctional protein HldE Helicobacter pylori (strain HPAG1)
P55264 3.43e-09 60 25 10 254 1 Adk Adenosine kinase Mus musculus
B6JM82 6.32e-09 60 28 6 258 3 hldE Bifunctional protein HldE Helicobacter pylori (strain P12)
O93919 6.49e-09 59 23 9 265 2 ADK Adenosine kinase Schizophyllum commune
P42720 6.86e-09 59 25 6 254 3 frk Fructokinase Rhizobium leguminosarum bv. trifolii
B5Z7L8 7.6e-09 60 28 6 259 3 hldE Bifunctional protein HldE Helicobacter pylori (strain G27)
Q64640 8.58e-09 59 25 9 256 1 Adk Adenosine kinase Rattus norvegicus
D4GYE6 9.89e-09 58 26 6 270 1 pfkB 1-phosphofructokinase Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)
A9KDJ2 1.5e-08 58 24 9 267 3 hldE Bifunctional protein HldE Coxiella burnetii (strain Dugway 5J108-111)
B2USX2 1.7e-08 58 26 7 263 3 hldE Bifunctional protein HldE Helicobacter pylori (strain Shi470)
Q31IC2 1.96e-08 58 22 7 263 3 hldE Bifunctional protein HldE Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
P55263 3.38e-08 57 24 7 253 1 ADK Adenosine kinase Homo sapiens
P26984 1.57e-07 55 23 8 288 3 scrK Fructokinase Salmonella typhimurium
Q17WK1 1.87e-07 55 27 6 258 3 hldE Bifunctional protein HldE Helicobacter acinonychis (strain Sheeba)
Q83B60 2.28e-07 55 24 9 254 3 hldE Bifunctional protein HldE Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9N9S2 2.28e-07 55 24 9 254 3 hldE Bifunctional protein HldE Coxiella burnetii (strain RSA 331 / Henzerling II)
Q9KM71 3.17e-07 54 24 9 306 2 fruk 1-phosphofructokinase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q39X60 4.32e-07 54 28 4 159 3 hldE Bifunctional protein HldE Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q7N0C3 4.68e-07 54 24 7 262 3 hldE Bifunctional protein HldE Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
O49923 4.73e-07 54 25 12 264 2 ADK Adenosine kinase Physcomitrium patens
P44482 4.95e-07 53 21 7 276 3 kdgK 2-dehydro-3-deoxygluconokinase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A8A4K6 1.27e-06 53 22 8 262 3 hldE Bifunctional protein HldE Escherichia coli O9:H4 (strain HS)
A6VP06 1.55e-06 52 21 5 297 3 hldE Bifunctional protein HldE Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q0C190 1.75e-06 52 25 10 313 3 hldE Bifunctional protein HldE Hyphomonas neptunium (strain ATCC 15444)
P0AEX2 2.02e-06 52 31 2 95 3 fruK 1-phosphofructokinase Shigella flexneri
P0AEW9 2.02e-06 52 31 2 95 1 fruK 1-phosphofructokinase Escherichia coli (strain K12)
P0AEX0 2.02e-06 52 31 2 95 3 fruK 1-phosphofructokinase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AEX1 2.02e-06 52 31 2 95 3 fruK 1-phosphofructokinase Escherichia coli O157:H7
Q74BF6 2.32e-06 52 24 11 276 3 hldE Bifunctional protein HldE Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
Q30T22 2.33e-06 52 25 14 309 3 hldE Bifunctional protein HldE Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
B7ND40 2.62e-06 52 22 7 260 3 hldE Bifunctional protein HldE Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q55480 2.93e-06 51 24 10 282 3 slr0537 Uncharacterized sugar kinase slr0537 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
A0RQR9 3.41e-06 52 22 8 262 3 hldE Bifunctional protein HldE Campylobacter fetus subsp. fetus (strain 82-40)
Q3J7Y0 3.8e-06 51 32 2 128 3 hldE Bifunctional protein HldE Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q0T0L1 4.02e-06 51 21 5 259 3 hldE Bifunctional protein HldE Shigella flexneri serotype 5b (strain 8401)
Q1R6S9 4.17e-06 51 21 5 259 3 hldE Bifunctional protein HldE Escherichia coli (strain UTI89 / UPEC)
Q8FDH5 4.17e-06 51 21 5 259 3 hldE Bifunctional protein HldE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
A1AFX4 4.17e-06 51 21 5 259 3 hldE Bifunctional protein HldE Escherichia coli O1:K1 / APEC
B7N0K1 4.17e-06 51 21 5 259 3 hldE Bifunctional protein HldE Escherichia coli O81 (strain ED1a)
B7MAC8 4.17e-06 51 21 5 259 3 hldE Bifunctional protein HldE Escherichia coli O45:K1 (strain S88 / ExPEC)
P78825 4.49e-06 51 23 10 262 2 ado1 Adenosine kinase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q3YXJ0 4.6e-06 51 22 7 260 3 hldE Bifunctional protein HldE Shigella sonnei (strain Ss046)
B1LF43 4.64e-06 51 22 7 260 3 hldE Bifunctional protein HldE Escherichia coli (strain SMS-3-5 / SECEC)
B6I423 4.64e-06 51 22 7 260 3 hldE Bifunctional protein HldE Escherichia coli (strain SE11)
P76658 4.64e-06 51 22 7 260 1 hldE Bifunctional protein HldE Escherichia coli (strain K12)
B1IRR4 4.64e-06 51 22 7 260 3 hldE Bifunctional protein HldE Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0TD55 4.64e-06 51 22 7 260 3 hldE Bifunctional protein HldE Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B1XG57 4.64e-06 51 22 7 260 3 hldE Bifunctional protein HldE Escherichia coli (strain K12 / DH10B)
C4ZQW9 4.64e-06 51 22 7 260 3 hldE Bifunctional protein HldE Escherichia coli (strain K12 / MC4100 / BW2952)
B7LZK1 4.64e-06 51 22 7 260 3 hldE Bifunctional protein HldE Escherichia coli O8 (strain IAI1)
B7NJR5 4.64e-06 51 22 7 260 3 hldE Bifunctional protein HldE Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YR91 4.64e-06 51 22 7 260 3 hldE Bifunctional protein HldE Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q7AAQ7 4.64e-06 51 22 7 260 3 hldE Bifunctional protein HldE Escherichia coli O157:H7
B7LGY7 4.64e-06 51 22 7 260 3 hldE Bifunctional protein HldE Escherichia coli (strain 55989 / EAEC)
B7UIW0 4.64e-06 51 22 7 260 3 hldE Bifunctional protein HldE Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZRT3 4.64e-06 51 22 7 260 3 hldE Bifunctional protein HldE Escherichia coli O139:H28 (strain E24377A / ETEC)
Q31WY3 4.9e-06 51 22 7 260 3 hldE Bifunctional protein HldE Shigella boydii serotype 4 (strain Sb227)
B2U1F7 4.9e-06 51 22 7 260 3 hldE Bifunctional protein HldE Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B4EW46 5.34e-06 51 23 7 261 3 hldE Bifunctional protein HldE Proteus mirabilis (strain HI4320)
A8FMK8 5.97e-06 51 26 13 275 3 hldE Bifunctional protein HldE Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
Q07Y78 6.94e-06 50 21 5 261 3 hldE Bifunctional protein HldE Shewanella frigidimarina (strain NCIMB 400)
Q7UBI8 7.74e-06 50 21 5 259 3 hldE Bifunctional protein HldE Shigella flexneri
Q32BR2 7.95e-06 50 22 7 260 3 hldE Bifunctional protein HldE Shigella dysenteriae serotype 1 (strain Sd197)
A7MP93 8.45e-06 50 22 5 259 3 hldE Bifunctional protein HldE Cronobacter sakazakii (strain ATCC BAA-894)
Q493X3 8.7e-06 50 22 6 260 3 hldE Bifunctional protein HldE Blochmanniella pennsylvanica (strain BPEN)
B7LQC9 8.85e-06 50 21 5 259 3 hldE Bifunctional protein HldE Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A5G6F4 9.22e-06 50 32 2 116 3 hldE Bifunctional protein HldE Geotalea uraniireducens (strain Rf4)
P44697 9.76e-06 49 29 2 115 3 thiD Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q7VQQ6 1.03e-05 50 21 6 258 3 hldE Bifunctional protein HldE Blochmanniella floridana
Q6D164 1.5e-05 50 22 6 265 3 hldE Bifunctional protein HldE Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q7VFZ3 1.64e-05 49 23 9 321 3 hldE Bifunctional protein HldE Helicobacter hepaticus (strain ATCC 51449 / 3B1)
P44330 1.76e-05 49 28 1 107 3 fruK 1-phosphofructokinase Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
B5EEZ1 1.86e-05 49 29 3 134 3 hldE Bifunctional protein HldE Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q65T41 1.88e-05 49 21 3 255 3 hldE Bifunctional protein HldE Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A4WEI4 2.11e-05 49 22 7 264 3 hldE Bifunctional protein HldE Enterobacter sp. (strain 638)
A8APT1 3.84e-05 48 22 6 262 3 hldE Bifunctional protein HldE Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A8GJU3 4.43e-05 48 21 6 261 3 hldE Bifunctional protein HldE Serratia proteamaculans (strain 568)
Q1PCB1 6.28e-05 47 36 3 94 1 Pdxk Pyridoxal kinase Bombyx mori
Q9LZG0 6.58e-05 47 28 4 128 1 ADK2 Adenosine kinase 2 Arabidopsis thaliana
A8H086 7.77e-05 47 27 4 179 3 hldE Bifunctional protein HldE Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B5XU40 9.38e-05 47 22 6 262 3 hldE Bifunctional protein HldE Klebsiella pneumoniae (strain 342)
A8EVR4 9.71e-05 47 31 6 151 3 hldE Bifunctional protein HldE Aliarcobacter butzleri (strain RM4018)
Q9SF85 0.0001 47 28 4 128 1 ADK1 Adenosine kinase 1 Arabidopsis thaliana
Q3IHX7 0.000117 47 28 0 115 3 hldE Bifunctional protein HldE Pseudoalteromonas translucida (strain TAC 125)
P47143 0.000153 46 23 11 272 1 ADO1 Adenosine kinase Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Q0I1X5 0.000156 46 20 4 257 3 hldE Bifunctional protein HldE Histophilus somni (strain 129Pt)
A6TE31 0.000167 46 21 6 262 3 hldE Bifunctional protein HldE Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q54MB5 0.000183 46 23 12 284 3 adk Adenosine kinase Dictyostelium discoideum
B5YZW5 0.000188 45 31 3 119 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XBL0 0.000188 45 31 3 119 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Escherichia coli O157:H7
A0KPL4 0.000196 46 26 2 133 3 hldE Bifunctional protein HldE Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B8CVJ1 0.000223 46 25 3 143 3 hldE Bifunctional protein HldE Shewanella piezotolerans (strain WP3 / JCM 13877)
B5BG11 0.000237 46 22 9 268 3 hldE Bifunctional protein HldE Salmonella paratyphi A (strain AKU_12601)
Q5PC86 0.000237 46 22 9 268 3 hldE Bifunctional protein HldE Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5REF8 0.000243 46 21 7 267 3 hldE Bifunctional protein HldE Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZ36 0.000243 46 21 7 267 3 hldE Bifunctional protein HldE Salmonella enteritidis PT4 (strain P125109)
Q7CPR9 0.000254 46 21 7 267 3 hldE Bifunctional protein HldE Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XEW9 0.000254 46 21 7 267 3 hldE Bifunctional protein HldE Salmonella typhi
B4TVT4 0.000254 46 21 7 267 3 hldE Bifunctional protein HldE Salmonella schwarzengrund (strain CVM19633)
C0PYX3 0.000254 46 21 7 267 3 hldE Bifunctional protein HldE Salmonella paratyphi C (strain RKS4594)
A9N5X8 0.000254 46 21 7 267 3 hldE Bifunctional protein HldE Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T670 0.000254 46 21 7 267 3 hldE Bifunctional protein HldE Salmonella newport (strain SL254)
B4TI51 0.000254 46 21 7 267 3 hldE Bifunctional protein HldE Salmonella heidelberg (strain SL476)
Q57JQ9 0.000254 46 21 7 267 3 hldE Bifunctional protein HldE Salmonella choleraesuis (strain SC-B67)
B5F696 0.000254 46 21 7 267 3 hldE Bifunctional protein HldE Salmonella agona (strain SL483)
B5FHT5 0.000273 45 21 7 267 3 hldE Bifunctional protein HldE Salmonella dublin (strain CT_02021853)
Q4KJA9 0.000286 45 28 2 127 3 hldE Bifunctional protein HldE Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A9MPW3 0.000293 45 22 8 263 3 hldE Bifunctional protein HldE Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A3MZC0 0.000306 45 21 5 264 3 hldE Bifunctional protein HldE Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B1JM26 0.00035 45 20 6 261 3 hldE Bifunctional protein HldE Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q665V3 0.00035 45 20 6 261 3 hldE Bifunctional protein HldE Yersinia pseudotuberculosis serotype I (strain IP32953)
B2K2H4 0.00035 45 20 6 261 3 hldE Bifunctional protein HldE Yersinia pseudotuberculosis serotype IB (strain PB1/+)
A7FE79 0.00035 45 20 6 261 3 hldE Bifunctional protein HldE Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
Q7VM30 0.000359 45 26 3 139 3 hldE Bifunctional protein HldE Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A4THT9 0.000363 45 20 6 261 3 hldE Bifunctional protein HldE Yersinia pestis (strain Pestoides F)
Q1CMD4 0.000363 45 20 6 261 3 hldE Bifunctional protein HldE Yersinia pestis bv. Antiqua (strain Nepal516)
A9R7D5 0.000363 45 20 6 261 3 hldE Bifunctional protein HldE Yersinia pestis bv. Antiqua (strain Angola)
Q8ZI60 0.000363 45 20 6 261 3 hldE Bifunctional protein HldE Yersinia pestis
Q1C374 0.000363 45 20 6 261 3 hldE Bifunctional protein HldE Yersinia pestis bv. Antiqua (strain Antiqua)
Q8GLU7 0.000379 45 21 5 264 3 hldE Bifunctional protein HldE Actinobacillus pleuropneumoniae
Q607M3 0.000382 45 27 1 115 3 hldE Bifunctional protein HldE Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q0HYC0 0.000453 45 20 5 261 3 hldE Bifunctional protein HldE Shewanella sp. (strain MR-7)
Q0HFL0 0.000453 45 20 5 261 3 hldE Bifunctional protein HldE Shewanella sp. (strain MR-4)
A1SZY2 0.000461 45 20 8 249 3 hldE Bifunctional protein HldE Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
A1JQV6 0.00047 45 21 6 261 3 hldE Bifunctional protein HldE Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q32DD5 0.000509 44 31 3 119 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Shigella dysenteriae serotype 1 (strain Sd197)
P76419 0.000509 44 22 8 309 3 yegV Uncharacterized sugar kinase YegV Escherichia coli (strain K12)
Q0VM60 0.000513 45 25 1 109 3 hldE Bifunctional protein HldE Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q5HTW1 0.00052 45 25 13 275 3 hldE Bifunctional protein HldE Campylobacter jejuni (strain RM1221)
B0TTF2 0.000566 45 27 3 141 3 hldE Bifunctional protein HldE Shewanella halifaxensis (strain HAW-EB4)
Q2NWD9 0.000589 45 26 1 115 3 hldE Bifunctional protein HldE Sodalis glossinidius (strain morsitans)
P06999 0.000629 44 24 9 262 1 pfkB ATP-dependent 6-phosphofructokinase isozyme 2 Escherichia coli (strain K12)
P82197 0.000681 44 47 1 51 1 PDXK Pyridoxal kinase Ovis aries
Q3YZC3 0.000687 44 31 3 119 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Shigella sonnei (strain Ss046)
B6I4Z5 0.000687 44 31 3 119 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Escherichia coli (strain SE11)
B7M6S8 0.000687 44 31 3 119 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Escherichia coli O8 (strain IAI1)
B7UGB9 0.000687 44 31 3 119 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZPL9 0.000687 44 31 3 119 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q83K78 0.000693 44 31 3 119 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Shigella flexneri
B2TX08 0.000731 44 31 3 119 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q0II59 0.000773 44 47 1 51 2 PDXK Pyridoxal kinase Bos taurus
C6DDL3 0.000809 44 22 6 264 3 hldE Bifunctional protein HldE Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q55EK9 0.000829 43 37 1 61 1 pykA Pyridoxal kinase Dictyostelium discoideum
B7N609 0.00083 43 31 3 119 3 pdxK Pyridoxine/pyridoxal/pyridoxamine kinase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q2W993 0.001 44 24 11 266 3 hldE Bifunctional protein HldE Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS00425
Feature type CDS
Gene rbsK
Product ribokinase
Location 115394 - 116320 (strand: -1)
Length 927 (nucleotides) / 308 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_164
Orthogroup size 10
N. genomes 7

Actions

Genomic region

Domains

PF00294 pfkB family carbohydrate kinase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0524 Carbohydrate transport and metabolism (G) G Sugar or nucleoside kinase, ribokinase family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00852 ribokinase [EC:2.7.1.15] Pentose phosphate pathway
Metabolic pathways
-

Protein Sequence

MTTPRLAVLGSINVDHIMNIAQFPKPGETVIGHDYKIAFGGKGANQAVACGRSGADITFIACVGDDAIGREIIAQLKTDNIDTDAIRIIPKTPTGVAMILVNEQGENVISIVAGANSALTPSHLHQYRHIIEQADALLMQLESPLDTVFEAAKQAKAHQTKVILNPAPAQPLSDEFLSFIDIITPNETEAEILTGISVHDEVGAAKAANILHSKGIKHVLITLGSRGVWFSEQGTGMIIPGFRVEAVDTIAAGDTFNGAFVTAILEGKSAHDAIRFAHAAAAIAVTRHGAQSSVPWRDEIKSFLAERA

Flanking regions ( +/- flanking 50bp)

CACTGCGTGGTTAGTTTCGTTATAAACTAGGTTTTCAAAGGATAAAGGCTATGACAACTCCCCGCCTTGCTGTTTTAGGTAGCATTAACGTTGACCATATTATGAATATTGCACAATTTCCCAAGCCCGGAGAAACCGTGATTGGTCATGACTATAAAATAGCATTTGGTGGTAAAGGGGCAAATCAAGCCGTCGCTTGTGGACGTAGTGGTGCCGATATCACGTTTATAGCCTGTGTGGGAGATGATGCTATTGGTCGCGAAATCATCGCTCAATTAAAAACAGATAATATTGATACTGATGCAATTCGTATTATTCCCAAGACACCTACAGGTGTAGCAATGATCCTAGTTAATGAACAAGGCGAAAATGTCATTAGCATTGTTGCCGGAGCAAATAGTGCTCTCACTCCAAGCCATTTGCATCAGTATCGTCATATTATTGAACAAGCAGATGCTTTATTAATGCAATTAGAATCCCCTCTAGACACTGTCTTTGAGGCAGCAAAACAAGCCAAAGCACATCAAACAAAAGTGATTTTAAATCCCGCTCCTGCACAGCCGTTATCTGATGAATTTCTGAGTTTTATTGATATTATTACGCCAAATGAGACAGAAGCCGAAATATTAACCGGTATTTCTGTGCATGATGAAGTGGGTGCAGCTAAAGCGGCTAATATTTTGCACAGTAAAGGCATAAAACACGTTTTAATCACTTTAGGCAGTCGTGGCGTATGGTTTAGTGAACAAGGCACCGGTATGATCATTCCCGGTTTTCGTGTTGAAGCAGTTGATACTATTGCCGCAGGTGATACCTTTAACGGTGCATTTGTTACAGCGATATTAGAAGGTAAATCAGCTCATGATGCGATCCGTTTCGCCCATGCAGCCGCGGCAATTGCAGTGACACGTCATGGCGCGCAATCCTCCGTCCCTTGGCGTGATGAAATTAAGTCATTTTTAGCAGAGCGAGCATAATATTTTGGCAACAATGAAAGATGTCGCCCGTTTAGCGGGTGTTTCAACAT