Homologs in group_2260

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17400 FBDBKF_17400 79.3 Morganella morganii S1 yajC preprotein translocase subunit YajC
EHELCC_17295 EHELCC_17295 79.3 Morganella morganii S2 yajC preprotein translocase subunit YajC
NLDBIP_17900 NLDBIP_17900 79.3 Morganella morganii S4 yajC preprotein translocase subunit YajC
LHKJJB_17820 LHKJJB_17820 79.3 Morganella morganii S3 yajC preprotein translocase subunit YajC
HKOGLL_17830 HKOGLL_17830 79.3 Morganella morganii S5 yajC preprotein translocase subunit YajC
F4V73_RS16575 F4V73_RS16575 79.3 Morganella psychrotolerans yajC preprotein translocase subunit YajC

Distribution of the homologs in the orthogroup group_2260

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2260

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AE00 1.22e-56 173 76 1 111 3 yajC Sec translocon accessory complex subunit YajC Shigella flexneri
P0ADZ7 1.22e-56 173 76 1 111 1 yajC Sec translocon accessory complex subunit YajC Escherichia coli (strain K12)
P0ADZ8 1.22e-56 173 76 1 111 3 yajC Sec translocon accessory complex subunit YajC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0ADZ9 1.22e-56 173 76 1 111 3 yajC Sec translocon accessory complex subunit YajC Escherichia coli O157:H7
Q8KA08 3.17e-43 139 57 1 111 3 yajC Sec translocon accessory complex subunit YajC Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57234 8.28e-42 136 54 0 111 3 yajC Sec translocon accessory complex subunit YajC Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
P44592 4.98e-33 113 58 1 91 3 yajC Sec translocon accessory complex subunit YajC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q89AV7 6.09e-32 111 44 1 110 3 yajC Sec translocon accessory complex subunit YajC Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
O67295 1.91e-16 71 36 1 91 3 yajC Sec translocon accessory complex subunit YajC Aquifex aeolicus (strain VF5)
Q4UKW4 1.98e-15 70 50 1 62 3 yajC Sec translocon accessory complex subunit YajC Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q68WF3 2.68e-15 69 47 1 63 3 yajC Sec translocon accessory complex subunit YajC Rickettsia typhi (strain ATCC VR-144 / Wilmington)
P0A4Q2 5.89e-15 68 34 2 104 3 yajC Sec translocon accessory complex subunit YajC Brucella suis biovar 1 (strain 1330)
P0A4Q1 5.89e-15 68 34 2 104 3 yajC Sec translocon accessory complex subunit YajC Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
P0C120 5.89e-15 68 34 2 104 3 yajC Sec translocon accessory complex subunit YajC Brucella abortus biovar 1 (strain 9-941)
Q2YNM1 5.89e-15 68 34 2 104 3 yajC Sec translocon accessory complex subunit YajC Brucella abortus (strain 2308)
Q92H78 5.94e-15 68 40 2 86 3 yajC Sec translocon accessory complex subunit YajC Rickettsia conorii (strain ATCC VR-613 / Malish 7)
O26075 7.31e-15 68 44 1 68 3 yajC Sec translocon accessory complex subunit YajC Helicobacter pylori (strain ATCC 700392 / 26695)
Q1RIN2 1.14e-14 68 49 1 61 3 yajC Sec translocon accessory complex subunit YajC Rickettsia bellii (strain RML369-C)
Q9ZCW9 1.22e-14 68 48 1 62 3 yajC Sec translocon accessory complex subunit YajC Rickettsia prowazekii (strain Madrid E)
Q9ZJ67 6.64e-14 65 40 1 74 3 yajC Sec translocon accessory complex subunit YajC Helicobacter pylori (strain J99 / ATCC 700824)
Q9WZW3 4.67e-13 63 35 1 81 3 yajC Sec translocon accessory complex subunit YajC Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q9KDI4 3.07e-11 58 32 2 80 3 yajC Sec translocon accessory complex subunit YajC Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
O32052 9.27e-11 57 35 2 80 3 yrbF Sec translocon accessory complex subunit YrbF Bacillus subtilis (strain 168)
O51595 2.79e-10 55 32 1 86 3 yajC Sec translocon accessory complex subunit YajC Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q9Z722 1.48e-07 49 37 1 74 3 yajC Sec translocon accessory complex subunit YajC Chlamydia pneumoniae
P58007 9.76e-06 44 32 1 73 3 yajC Sec translocon accessory complex subunit YajC Treponema pallidum (strain Nichols)
O84746 0.000158 41 33 1 65 3 yajC Sec translocon accessory complex subunit YajC Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q9PLI2 0.000248 40 34 2 69 3 yajC Sec translocon accessory complex subunit YajC Chlamydia muridarum (strain MoPn / Nigg)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS00370
Feature type CDS
Gene yajC
Product preprotein translocase subunit YajC
Location 105594 - 105929 (strand: 1)
Length 336 (nucleotides) / 111 (amino acids)

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2260
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02699 Preprotein translocase subunit

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1862 Intracellular trafficking, secretion, and vesicular transport (U) U Protein translocase subunit YajC

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03210 preprotein translocase subunit YajC Quorum sensing
Protein export
Bacterial secretion system		 -

Protein Sequence

MSFFISDAVASAGQAAPEASFMSILPMLVIFILIFYFMILRPQQKRTKEHRKLMESIGKGDEVLTTGGLIGRVVKVSDNGYIVVALNETTEVTIKRDFVAAVLPKGTMKAI

Flanking regions ( +/- flanking 50bp)

GGCTTATAACTTGAGTATCGTCGATATCGACAACAATGAGGAAAAAGTGAATGAGTTTTTTCATTTCTGATGCTGTTGCTTCTGCTGGACAAGCAGCACCTGAAGCAAGCTTTATGTCTATTTTACCGATGTTAGTGATCTTTATTTTAATTTTCTATTTTATGATCCTACGTCCTCAGCAAAAACGTACTAAAGAACACCGTAAACTGATGGAATCTATCGGTAAAGGTGATGAAGTGTTAACTACTGGTGGTTTAATCGGCCGCGTTGTTAAAGTTTCAGATAACGGCTATATCGTTGTTGCTCTGAATGAAACAACTGAAGTAACTATCAAACGTGACTTTGTTGCCGCTGTATTACCAAAAGGCACAATGAAAGCTATTTAATTTGATTTCCCCAAAGGGAAAAGGGAACTGCCGTGCTAAACCGTTATCCT