Homologs in group_2306

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17460 FBDBKF_17460 72.4 Morganella morganii S1 rdgC recombination-associated protein RdgC
EHELCC_17355 EHELCC_17355 72.4 Morganella morganii S2 rdgC recombination-associated protein RdgC
NLDBIP_17840 NLDBIP_17840 72.4 Morganella morganii S4 rdgC recombination-associated protein RdgC
LHKJJB_17760 LHKJJB_17760 72.4 Morganella morganii S3 rdgC recombination-associated protein RdgC
HKOGLL_17770 HKOGLL_17770 72.4 Morganella morganii S5 rdgC recombination-associated protein RdgC
F4V73_RS16635 F4V73_RS16635 72.4 Morganella psychrotolerans rdgC recombination-associated protein RdgC

Distribution of the homologs in the orthogroup group_2306

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2306

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B4F2X9 0.0 612 100 0 302 3 rdgC Recombination-associated protein RdgC Proteus mirabilis (strain HI4320)
Q7N0G0 3.35e-175 489 74 0 302 3 rdgC Recombination-associated protein RdgC Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A8GAJ1 2.31e-163 459 69 0 302 3 rdgC Recombination-associated protein RdgC Serratia proteamaculans (strain 568)
A1JNV0 1.02e-162 457 69 0 302 3 rdgC Recombination-associated protein RdgC Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B1JIG5 1.08e-162 457 69 0 302 3 rdgC Recombination-associated protein RdgC Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A4TPJ2 1.08e-162 457 69 0 302 3 rdgC Recombination-associated protein RdgC Yersinia pestis (strain Pestoides F)
Q1CLB8 1.08e-162 457 69 0 302 3 rdgC Recombination-associated protein RdgC Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZC18 1.08e-162 457 69 0 302 3 rdgC Recombination-associated protein RdgC Yersinia pestis
B2K6R1 1.08e-162 457 69 0 302 3 rdgC Recombination-associated protein RdgC Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C4F5 1.08e-162 457 69 0 302 3 rdgC Recombination-associated protein RdgC Yersinia pestis bv. Antiqua (strain Antiqua)
A7FLH3 1.08e-162 457 69 0 302 3 rdgC Recombination-associated protein RdgC Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A9R2W1 4.16e-162 456 68 0 302 3 rdgC Recombination-associated protein RdgC Yersinia pestis bv. Antiqua (strain Angola)
B2VIS2 6.69e-159 447 68 0 302 3 rdgC Recombination-associated protein RdgC Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A6T5B7 4.52e-156 441 67 0 302 3 rdgC Recombination-associated protein RdgC Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5Y109 4.52e-156 441 67 0 302 3 rdgC Recombination-associated protein RdgC Klebsiella pneumoniae (strain 342)
P65973 2.85e-155 438 67 0 302 3 rdgC Recombination-associated protein RdgC Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P65974 2.85e-155 438 67 0 302 3 rdgC Recombination-associated protein RdgC Salmonella typhi
B4TZG5 2.85e-155 438 67 0 302 3 rdgC Recombination-associated protein RdgC Salmonella schwarzengrund (strain CVM19633)
A9MX46 2.85e-155 438 67 0 302 3 rdgC Recombination-associated protein RdgC Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4T8N1 2.85e-155 438 67 0 302 3 rdgC Recombination-associated protein RdgC Salmonella heidelberg (strain SL476)
B5R5Y3 2.85e-155 438 67 0 302 3 rdgC Recombination-associated protein RdgC Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5FKP7 2.85e-155 438 67 0 302 3 rdgC Recombination-associated protein RdgC Salmonella dublin (strain CT_02021853)
B5EWS4 2.85e-155 438 67 0 302 3 rdgC Recombination-associated protein RdgC Salmonella agona (strain SL483)
B4SWN2 2.94e-155 438 67 0 302 3 rdgC Recombination-associated protein RdgC Salmonella newport (strain SL254)
Q83M63 1.04e-154 437 67 0 302 3 rdgC Recombination-associated protein RdgC Shigella flexneri
Q32JE7 2.69e-154 436 66 0 302 3 rdgC Recombination-associated protein RdgC Shigella dysenteriae serotype 1 (strain Sd197)
Q325K5 2.69e-154 436 66 0 302 3 rdgC Recombination-associated protein RdgC Shigella boydii serotype 4 (strain Sb227)
B2U3Z6 2.69e-154 436 66 0 302 3 rdgC Recombination-associated protein RdgC Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1LIS7 2.69e-154 436 66 0 302 3 rdgC Recombination-associated protein RdgC Escherichia coli (strain SMS-3-5 / SECEC)
B6HZJ3 2.69e-154 436 66 0 302 3 rdgC Recombination-associated protein RdgC Escherichia coli (strain SE11)
B7N8U5 2.69e-154 436 66 0 302 3 rdgC Recombination-associated protein RdgC Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P36767 2.69e-154 436 66 0 302 1 rdgC Recombination-associated protein RdgC Escherichia coli (strain K12)
B1J055 2.69e-154 436 66 0 302 3 rdgC Recombination-associated protein RdgC Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q8FKD5 2.69e-154 436 66 0 302 3 rdgC Recombination-associated protein RdgC Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TKP7 2.69e-154 436 66 0 302 3 rdgC Recombination-associated protein RdgC Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A7ZX42 2.69e-154 436 66 0 302 3 rdgC Recombination-associated protein RdgC Escherichia coli O9:H4 (strain HS)
B1XEY2 2.69e-154 436 66 0 302 3 rdgC Recombination-associated protein RdgC Escherichia coli (strain K12 / DH10B)
C4ZTF1 2.69e-154 436 66 0 302 3 rdgC Recombination-associated protein RdgC Escherichia coli (strain K12 / MC4100 / BW2952)
B7M3N2 2.69e-154 436 66 0 302 3 rdgC Recombination-associated protein RdgC Escherichia coli O8 (strain IAI1)
B7MPF4 2.69e-154 436 66 0 302 3 rdgC Recombination-associated protein RdgC Escherichia coli O81 (strain ED1a)
B7NJA9 2.69e-154 436 66 0 302 3 rdgC Recombination-associated protein RdgC Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B7L548 2.69e-154 436 66 0 302 3 rdgC Recombination-associated protein RdgC Escherichia coli (strain 55989 / EAEC)
B7MD52 2.69e-154 436 66 0 302 3 rdgC Recombination-associated protein RdgC Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UJL7 2.69e-154 436 66 0 302 3 rdgC Recombination-associated protein RdgC Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZIE2 2.69e-154 436 66 0 302 3 rdgC Recombination-associated protein RdgC Escherichia coli O139:H28 (strain E24377A / ETEC)
B5Z2U5 3e-154 436 66 0 302 3 rdgC Recombination-associated protein RdgC Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8XEA1 3e-154 436 66 0 302 3 rdgC Recombination-associated protein RdgC Escherichia coli O157:H7
B7LMJ3 1.07e-153 434 66 0 302 3 rdgC Recombination-associated protein RdgC Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
C5BHP0 1.99e-153 434 67 0 300 3 rdgC Recombination-associated protein RdgC Edwardsiella ictaluri (strain 93-146)
Q3Z515 3.88e-153 433 66 0 302 3 rdgC Recombination-associated protein RdgC Shigella sonnei (strain Ss046)
A4W767 4.26e-151 428 64 0 302 3 rdgC Recombination-associated protein RdgC Enterobacter sp. (strain 638)
Q2NVB3 2.71e-149 423 64 0 301 3 rdgC Recombination-associated protein RdgC Sodalis glossinidius (strain morsitans)
A7MT92 2.19e-124 360 56 0 298 3 rdgC Recombination-associated protein RdgC Vibrio campbellii (strain ATCC BAA-1116)
Q87S56 7.45e-124 359 56 0 298 3 rdgC Recombination-associated protein RdgC Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q7MNJ5 2.04e-119 348 57 0 298 3 rdgC Recombination-associated protein RdgC Vibrio vulnificus (strain YJ016)
Q8DEV7 2.68e-119 347 57 0 298 3 rdgC Recombination-associated protein RdgC Vibrio vulnificus (strain CMCP6)
C3LSX1 2.95e-119 347 54 0 298 3 rdgC Recombination-associated protein RdgC Vibrio cholerae serotype O1 (strain M66-2)
Q9KU12 2.95e-119 347 54 0 298 3 rdgC Recombination-associated protein RdgC Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
C4K8J6 3.68e-117 342 52 0 302 3 rdgC Recombination-associated protein RdgC Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
A6VQG4 8.36e-117 341 53 3 301 3 rdgC Recombination-associated protein RdgC Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A1SWV9 9.32e-117 341 53 0 299 3 rdgC Recombination-associated protein RdgC Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B7VJP8 1.43e-116 340 53 0 298 3 rdgC Recombination-associated protein RdgC Vibrio atlanticus (strain LGP32)
Q65RK3 1.81e-116 340 55 3 301 3 rdgC Recombination-associated protein RdgC Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
A0KMP9 2.76e-114 335 54 0 299 3 rdgC Recombination-associated protein RdgC Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
C4L7Q5 1.52e-111 328 52 0 299 3 rdgC Recombination-associated protein RdgC Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
P57810 7.39e-111 326 53 3 301 3 rdgC Recombination-associated protein RdgC Pasteurella multocida (strain Pm70)
A3MYN3 3.84e-110 324 53 3 300 3 rdgC Recombination-associated protein RdgC Actinobacillus pleuropneumoniae serotype 5b (strain L20)
B0BS66 5.57e-108 318 54 3 300 3 rdgC Recombination-associated protein RdgC Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H003 3.84e-105 311 53 3 300 3 rdgC Recombination-associated protein RdgC Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A8H6V1 5.1e-104 308 48 0 298 3 rdgC Recombination-associated protein RdgC Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
P44628 7.63e-104 308 51 4 301 1 rdgC Recombination-associated protein RdgC Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UGC4 7.63e-104 308 51 4 301 3 rdgC Recombination-associated protein RdgC Haemophilus influenzae (strain PittGG)
B0TPG2 4.67e-103 306 48 0 298 3 rdgC Recombination-associated protein RdgC Shewanella halifaxensis (strain HAW-EB4)
B8CKL7 3.13e-100 299 47 0 298 3 rdgC Recombination-associated protein RdgC Shewanella piezotolerans (strain WP3 / JCM 13877)
A8FYI7 3.27e-100 299 47 0 298 3 rdgC Recombination-associated protein RdgC Shewanella sediminis (strain HAW-EB3)
A3QGL9 1.09e-99 298 46 0 298 3 rdgC Recombination-associated protein RdgC Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q8EGP3 2.62e-99 296 46 0 298 3 rdgC Recombination-associated protein RdgC Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A1RLT1 1.18e-98 295 47 0 298 3 rdgC Recombination-associated protein RdgC Shewanella sp. (strain W3-18-1)
A0KZ89 2.42e-98 294 46 0 298 3 rdgC Recombination-associated protein RdgC Shewanella sp. (strain ANA-3)
Q0HSZ1 2.7e-98 294 46 0 298 3 rdgC Recombination-associated protein RdgC Shewanella sp. (strain MR-7)
Q0HGN5 2.7e-98 294 46 0 298 3 rdgC Recombination-associated protein RdgC Shewanella sp. (strain MR-4)
A3D2D1 1.8e-97 292 46 0 298 3 rdgC Recombination-associated protein RdgC Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EAS7 1.8e-97 292 46 0 298 3 rdgC Recombination-associated protein RdgC Shewanella baltica (strain OS223)
Q07ZF4 2.31e-97 291 47 0 297 3 rdgC Recombination-associated protein RdgC Shewanella frigidimarina (strain NCIMB 400)
A4Y4Y9 3.66e-97 291 46 0 298 3 rdgC Recombination-associated protein RdgC Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q12KQ6 4.12e-97 291 46 0 297 3 rdgC Recombination-associated protein RdgC Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A9KTN4 9.23e-97 290 46 0 298 3 rdgC Recombination-associated protein RdgC Shewanella baltica (strain OS195)
A6WL23 9.43e-97 290 46 0 298 3 rdgC Recombination-associated protein RdgC Shewanella baltica (strain OS185)
Q9HYX7 3.85e-87 266 44 1 300 1 rdgC Recombination-associated protein RdgC Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02Q95 6.22e-87 265 44 1 300 3 rdgC Recombination-associated protein RdgC Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V7J4 6.22e-87 265 44 1 300 3 rdgC Recombination-associated protein RdgC Pseudomonas aeruginosa (strain LESB58)
A6V2F6 8.52e-87 265 44 1 300 3 rdgC Recombination-associated protein RdgC Pseudomonas aeruginosa (strain PA7)
B0KTR8 9.92e-87 265 43 2 301 3 rdgC Recombination-associated protein RdgC Pseudomonas putida (strain GB-1)
Q88M72 1.08e-86 265 43 2 301 3 rdgC Recombination-associated protein RdgC Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q1IDH6 2.56e-86 263 43 1 300 3 rdgC Recombination-associated protein RdgC Pseudomonas entomophila (strain L48)
Q486R8 6.16e-86 263 42 1 297 3 rdgC Recombination-associated protein RdgC Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q3KFP5 2.27e-85 261 42 2 301 3 rdgC Recombination-associated protein RdgC Pseudomonas fluorescens (strain Pf0-1)
Q3II43 1.13e-84 259 42 0 297 3 rdgC Recombination-associated protein RdgC Pseudoalteromonas translucida (strain TAC 125)
C3K7N8 1.87e-84 259 42 2 301 3 rdgC Recombination-associated protein RdgC Pseudomonas fluorescens (strain SBW25)
Q15X11 8.54e-82 252 39 2 297 3 rdgC Recombination-associated protein RdgC Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q87YA4 1.41e-81 251 41 2 301 3 rdgC Recombination-associated protein RdgC Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q4K8D9 3.41e-81 251 41 2 301 3 rdgC Recombination-associated protein RdgC Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q48LA4 4.43e-81 250 41 2 301 3 rdgC Recombination-associated protein RdgC Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q21NJ1 4.99e-81 250 38 1 298 3 rdgC Recombination-associated protein RdgC Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q4ZW36 6.06e-81 250 41 2 301 3 rdgC Recombination-associated protein RdgC Pseudomonas syringae pv. syringae (strain B728a)
A1WYS1 1.81e-75 236 39 1 299 3 rdgC Recombination-associated protein RdgC Halorhodospira halophila (strain DSM 244 / SL1)
A4G416 1.57e-71 226 38 2 299 3 rdgC Recombination-associated protein RdgC Herminiimonas arsenicoxydans
A6SX69 6.44e-69 219 38 3 301 3 rdgC Recombination-associated protein RdgC Janthinobacterium sp. (strain Marseille)
Q46X89 1.62e-68 218 38 3 299 3 rdgC Recombination-associated protein RdgC Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q478Z5 2.94e-66 212 36 4 303 3 rdgC Recombination-associated protein RdgC Dechloromonas aromatica (strain RCB)
Q0K6V7 5.11e-64 206 37 3 299 3 rdgC Recombination-associated protein RdgC Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B3R6L9 6.91e-64 206 38 3 299 3 rdgC Recombination-associated protein RdgC Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
B2JRS8 5.18e-63 204 35 2 299 3 rdgC Recombination-associated protein RdgC Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
B1K4Q5 9.18e-63 203 36 2 298 3 rdgC Recombination-associated protein RdgC Burkholderia orbicola (strain MC0-3)
B4EK21 1.03e-62 203 36 2 299 3 rdgC Recombination-associated protein RdgC Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
Q7W7A7 1.6e-62 202 34 2 299 3 rdgC Recombination-associated protein RdgC Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7VVS6 2.77e-62 202 34 2 299 3 rdgC Recombination-associated protein RdgC Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7WKP4 2.77e-62 202 34 2 299 3 rdgC Recombination-associated protein RdgC Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
B1YWR8 2.75e-61 199 35 2 299 3 rdgC Recombination-associated protein RdgC Burkholderia ambifaria (strain MC40-6)
Q8Y1S1 4.86e-61 199 34 2 299 3 rdgC Recombination-associated protein RdgC Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
C1D4B9 2.28e-58 192 35 3 301 3 rdgC Recombination-associated protein RdgC Laribacter hongkongensis (strain HLHK9)
B4SRP4 1.2e-56 187 35 2 290 3 rdgC Recombination-associated protein RdgC Stenotrophomonas maltophilia (strain R551-3)
Q8PEW7 9.89e-56 185 35 2 290 3 rdgC Recombination-associated protein RdgC Xanthomonas axonopodis pv. citri (strain 306)
Q8P3H3 1.32e-55 185 35 2 290 3 rdgC Recombination-associated protein RdgC Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RYY7 1.32e-55 185 35 2 290 3 rdgC Recombination-associated protein RdgC Xanthomonas campestris pv. campestris (strain B100)
Q4UNZ6 1.32e-55 185 35 2 290 3 rdgC Recombination-associated protein RdgC Xanthomonas campestris pv. campestris (strain 8004)
Q5GUF4 7.38e-55 183 35 2 290 3 rdgC Recombination-associated protein RdgC Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SIG8 7.38e-55 183 35 2 290 3 rdgC Recombination-associated protein RdgC Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NXR4 9.97e-55 182 35 2 290 3 rdgC Recombination-associated protein RdgC Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q87B84 2.96e-53 179 35 2 290 3 rdgC Recombination-associated protein RdgC Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I7H2 2.96e-53 179 35 2 290 3 rdgC Recombination-associated protein RdgC Xylella fastidiosa (strain M23)
Q9PFT9 5e-53 178 35 2 290 3 rdgC Recombination-associated protein RdgC Xylella fastidiosa (strain 9a5c)
B0U454 6.4e-53 178 35 2 290 3 rdgC Recombination-associated protein RdgC Xylella fastidiosa (strain M12)
B4RKD1 3.95e-51 173 33 3 302 3 rdgC Recombination-associated protein RdgC Neisseria gonorrhoeae (strain NCCP11945)
O87408 3.95e-51 173 33 3 302 3 rdgC Recombination-associated protein RdgC Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
A9M3Z9 4.31e-51 173 33 3 302 3 rdgC Recombination-associated protein RdgC Neisseria meningitidis serogroup C (strain 053442)
A1KT92 5.34e-51 173 33 3 302 3 rdgC Recombination-associated protein RdgC Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9JZY2 5.34e-51 173 33 3 302 3 rdgC Recombination-associated protein RdgC Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JV02 8.46e-51 172 33 3 302 3 rdgC Recombination-associated protein RdgC Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)

  • Number of RefSeq hits:

General

Source Proteus mirabilis HI4320
Locus tag PMI_RS00210
Feature type CDS
Gene rdgC
Product recombination-associated protein RdgC
Location 64753 - 65661 (strand: -1)
Length 909 (nucleotides) / 302 (amino acids)
In genomic island -

Contig

Accession NC_010554
Length 4063606 nucleotides
Topology circular
Plasmid False

Orthology

Orthogroup group_2306
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF04381 Putative exonuclease, RdgC

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2974 Replication, recombination and repair (L) L DNA recombination-dependent growth factor RdgC

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03554 recombination associated protein RdgC - -

Protein Sequence

MLWFKNILVYRLNKEIALSMDELEQQLASLAFTPCSSQDMTKTGWVSPMGDRGEALIHVAGKQVMMCARKEDKILPATVIKQALQDKVEKLEGEQGRKLKKTEKATLKDEVVHTLLPRAFSKFSQTFIWLDLDKQLVIVDSGSAKRAEDNLALLRKTLGSLPVVPLNFNESVESKMTQWVRSGELPAGFTLMDEAELKAVLEEGGVIRCKKQELVSDEIATHIEAGKFVTKLSLDWEDRLQFMLCDDGSIKRIKFSDTLREQNDDIDKADFAQRFDADFVLMTGELSALIERVIEVLGGEAE

Flanking regions ( +/- flanking 50bp)

CTAACATTCAGTATCATATTGCTGTTAATCATGATTAAGGGGAATGTCAGATGCTGTGGTTTAAAAATATTTTGGTCTATCGCTTAAATAAAGAGATAGCGCTGTCAATGGATGAGTTAGAACAACAGCTGGCTTCATTAGCATTCACCCCTTGTAGTAGCCAAGATATGACCAAAACGGGTTGGGTTTCACCTATGGGTGATCGTGGCGAAGCACTTATCCATGTTGCAGGTAAACAAGTCATGATGTGCGCACGGAAAGAAGATAAGATCCTCCCCGCCACCGTCATTAAGCAAGCGCTACAAGATAAAGTTGAAAAGTTAGAGGGTGAACAAGGTCGTAAATTAAAGAAAACCGAAAAAGCGACATTAAAAGATGAAGTTGTCCACACGTTACTTCCTCGCGCATTTAGCAAATTCTCACAAACCTTTATTTGGTTAGATTTAGATAAACAATTAGTGATTGTTGATTCAGGTAGTGCAAAACGTGCCGAAGATAATTTAGCCTTATTGCGTAAAACATTAGGTTCGCTACCCGTGGTTCCACTCAATTTTAATGAGTCTGTCGAATCAAAAATGACACAATGGGTTCGTTCCGGTGAACTCCCTGCTGGTTTTACATTAATGGATGAAGCCGAGCTTAAAGCGGTATTAGAAGAAGGTGGCGTGATACGTTGTAAGAAACAAGAGCTTGTCTCTGATGAAATTGCCACTCATATTGAAGCCGGTAAGTTTGTCACCAAGCTTTCTCTTGATTGGGAAGATCGCCTGCAATTCATGCTTTGTGATGATGGCTCTATCAAGCGCATTAAATTTAGTGATACCTTGCGTGAGCAAAACGATGATATTGATAAAGCCGATTTTGCCCAGCGTTTTGATGCCGATTTTGTCTTAATGACAGGTGAACTAAGCGCGCTAATTGAAAGGGTTATCGAAGTACTTGGTGGTGAAGCCGAGTAATTTTATCACCCGATATCATAGTACAAAAAAACAGCCTATCTCACGCTATG