Homologs in group_188

Help

8 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_13100 FBDBKF_13100 98.7 Morganella morganii S1 - DUF2190 domain-containing protein
EHELCC_19935 EHELCC_19935 98.7 Morganella morganii S2 - DUF2190 domain-containing protein
EHELCC_20005 EHELCC_20005 100.0 Morganella morganii S2 - hypothetical protein
NLDBIP_19810 NLDBIP_19810 98.7 Morganella morganii S4 - DUF2190 domain-containing protein
LHKJJB_19775 LHKJJB_19775 98.7 Morganella morganii S3 - DUF2190 domain-containing protein
LHKJJB_19975 LHKJJB_19975 100.0 Morganella morganii S3 - hypothetical protein
HKOGLL_05970 HKOGLL_05970 98.7 Morganella morganii S5 - DUF2190 domain-containing protein
F4V73_RS02165 F4V73_RS02165 69.2 Morganella psychrotolerans - DUF2190 family protein

Distribution of the homologs in the orthogroup group_188

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_188

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_19990
Feature type CDS
Gene -
Product hypothetical protein
Location 2 - 238 (strand: 1)
Length 237 (nucleotides) / 78 (amino acids)
In genomic island -

Contig

Accession ZDB_664
Length 255 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_188
Orthogroup size 9
N. genomes 6

Actions

Genomic region

Domains

PF09956 Uncharacterized conserved protein (DUF2190)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG5471 Mobilome: prophages, transposons (X) X Predicted phage recombinase, RecA/RadA family

Protein Sequence

MAITDIAAGATGDGFAEGVFRLPKKNGLVLKAGAAASVKDGQLVDTGGVVIGVAWEDAAAGDADAAVKINVFPPAAQG

Flanking regions ( +/- flanking 50bp)

GGTGGCAATTACAGACATTGCCGCCGGTGCAACCGGTGACGGATTTGCCGAAGGGGTTTTCCGGCTGCCTAAAAAAAACGGGCTGGTGCTTAAAGCGGGGGCGGCGGCTTCCGTTAAAGACGGTCAGTTGGTGGATACCGGCGGCGTGGTGATCGGCGTAGCCTGGGAGGATGCGGCTGCCGGTGACGCAGATGCCGCTGTGAAGATTAACGTCTTCCCGCCGGCGGCACAGGGATAACGCTATGACCCCGTTT