Homologs in group_2415

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19160 FBDBKF_19160 100.0 Morganella morganii S1 rpsE 30S ribosomal protein S5
EHELCC_18905 EHELCC_18905 100.0 Morganella morganii S2 rpsE 30S ribosomal protein S5
LHKJJB_18775 LHKJJB_18775 100.0 Morganella morganii S3 rpsE 30S ribosomal protein S5
HKOGLL_18510 HKOGLL_18510 100.0 Morganella morganii S5 rpsE 30S ribosomal protein S5
F4V73_RS19005 F4V73_RS19005 97.6 Morganella psychrotolerans rpsE 30S ribosomal protein S5
PMI_RS16235 PMI_RS16235 99.4 Proteus mirabilis HI4320 rpsE 30S ribosomal protein S5

Distribution of the homologs in the orthogroup group_2415

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2415

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7MYG8 2.32e-116 329 98 0 166 3 rpsE Small ribosomal subunit protein uS5 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A6TEV5 1.26e-108 309 93 0 166 3 rpsE Small ribosomal subunit protein uS5 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q6CZY7 5.24e-108 308 93 0 166 3 rpsE Small ribosomal subunit protein uS5 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q2NQN9 7.28e-108 307 92 0 166 3 rpsE Small ribosomal subunit protein uS5 Sodalis glossinidius (strain morsitans)
Q32B48 1.36e-107 306 92 0 166 3 rpsE Small ribosomal subunit protein uS5 Shigella dysenteriae serotype 1 (strain Sd197)
Q3YWV6 1.52e-107 306 92 0 166 3 rpsE Small ribosomal subunit protein uS5 Shigella sonnei (strain Ss046)
P0A7W6 1.52e-107 306 92 0 166 3 rpsE Small ribosomal subunit protein uS5 Shigella flexneri
Q0SZZ9 1.52e-107 306 92 0 166 3 rpsE Small ribosomal subunit protein uS5 Shigella flexneri serotype 5b (strain 8401)
Q31VX3 1.52e-107 306 92 0 166 3 rpsE Small ribosomal subunit protein uS5 Shigella boydii serotype 4 (strain Sb227)
P0A7W4 1.52e-107 306 92 0 166 1 rpsE Small ribosomal subunit protein uS5 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A7W5 1.52e-107 306 92 0 166 3 rpsE Small ribosomal subunit protein uS5 Salmonella typhi
A9MSY1 1.52e-107 306 92 0 166 3 rpsE Small ribosomal subunit protein uS5 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PK01 1.52e-107 306 92 0 166 3 rpsE Small ribosomal subunit protein uS5 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57J49 1.52e-107 306 92 0 166 3 rpsE Small ribosomal subunit protein uS5 Salmonella choleraesuis (strain SC-B67)
A9MN66 1.52e-107 306 92 0 166 3 rpsE Small ribosomal subunit protein uS5 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q1R627 1.52e-107 306 92 0 166 3 rpsE Small ribosomal subunit protein uS5 Escherichia coli (strain UTI89 / UPEC)
P0A7W1 1.52e-107 306 92 0 166 1 rpsE Small ribosomal subunit protein uS5 Escherichia coli (strain K12)
B1IPZ6 1.52e-107 306 92 0 166 3 rpsE Small ribosomal subunit protein uS5 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7W2 1.52e-107 306 92 0 166 3 rpsE Small ribosomal subunit protein uS5 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCF8 1.52e-107 306 92 0 166 3 rpsE Small ribosomal subunit protein uS5 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AGJ2 1.52e-107 306 92 0 166 3 rpsE Small ribosomal subunit protein uS5 Escherichia coli O1:K1 / APEC
A8A5A8 1.52e-107 306 92 0 166 3 rpsE Small ribosomal subunit protein uS5 Escherichia coli O9:H4 (strain HS)
P0A7W3 1.52e-107 306 92 0 166 3 rpsE Small ribosomal subunit protein uS5 Escherichia coli O157:H7
A7ZSJ2 1.52e-107 306 92 0 166 3 rpsE Small ribosomal subunit protein uS5 Escherichia coli O139:H28 (strain E24377A / ETEC)
A8AQJ8 1.52e-107 306 92 0 166 3 rpsE Small ribosomal subunit protein uS5 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A7MPG7 6.39e-107 305 92 0 166 3 rpsE Small ribosomal subunit protein uS5 Cronobacter sakazakii (strain ATCC BAA-894)
A4WFB1 1.11e-106 304 92 0 166 3 rpsE Small ribosomal subunit protein uS5 Enterobacter sp. (strain 638)
Q664T8 2.55e-106 303 92 0 166 3 rpsE Small ribosomal subunit protein uS5 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TH09 2.55e-106 303 92 0 166 3 rpsE Small ribosomal subunit protein uS5 Yersinia pestis (strain Pestoides F)
Q1CCW1 2.55e-106 303 92 0 166 3 rpsE Small ribosomal subunit protein uS5 Yersinia pestis bv. Antiqua (strain Nepal516)
Q8ZJ95 2.55e-106 303 92 0 166 3 rpsE Small ribosomal subunit protein uS5 Yersinia pestis
Q1C2W4 2.55e-106 303 92 0 166 3 rpsE Small ribosomal subunit protein uS5 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FNL7 2.55e-106 303 92 0 166 3 rpsE Small ribosomal subunit protein uS5 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A8GKI0 5.26e-106 303 92 0 166 3 rpsE Small ribosomal subunit protein uS5 Serratia proteamaculans (strain 568)
A3N374 6.76e-106 302 90 0 166 3 rpsE Small ribosomal subunit protein uS5 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A1JS11 1.2e-105 302 91 0 166 3 rpsE Small ribosomal subunit protein uS5 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B0UX31 1.46e-105 301 90 0 166 3 rpsE Small ribosomal subunit protein uS5 Histophilus somni (strain 2336)
Q0I145 1.46e-105 301 90 0 166 3 rpsE Small ribosomal subunit protein uS5 Histophilus somni (strain 129Pt)
Q9CL47 3.66e-105 300 90 0 166 3 rpsE Small ribosomal subunit protein uS5 Pasteurella multocida (strain Pm70)
Q65QX2 2.52e-104 298 90 0 166 3 rpsE Small ribosomal subunit protein uS5 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P44374 2.98e-104 298 89 0 166 3 rpsE Small ribosomal subunit protein uS5 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UHU8 2.98e-104 298 89 0 166 3 rpsE Small ribosomal subunit protein uS5 Haemophilus influenzae (strain PittGG)
A5UDT0 2.98e-104 298 89 0 166 3 rpsE Small ribosomal subunit protein uS5 Haemophilus influenzae (strain PittEE)
Q4QMA4 2.98e-104 298 89 0 166 3 rpsE Small ribosomal subunit protein uS5 Haemophilus influenzae (strain 86-028NP)
Q7VKF0 3.92e-104 298 89 0 166 3 rpsE Small ribosomal subunit protein uS5 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A6VLK5 9.95e-104 297 89 0 166 3 rpsE Small ribosomal subunit protein uS5 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q1LTC1 2.23e-99 286 84 1 166 3 rpsE Small ribosomal subunit protein uS5 Baumannia cicadellinicola subsp. Homalodisca coagulata
Q87SZ6 9.49e-96 277 86 0 158 3 rpsE Small ribosomal subunit protein uS5 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MWH5 9.49e-96 277 86 0 158 3 rpsE Small ribosomal subunit protein uS5 Vibrio campbellii (strain ATCC BAA-1116)
A1S235 1.61e-94 274 82 1 168 3 rpsE Small ribosomal subunit protein uS5 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
A4SSY9 1.83e-94 273 81 0 166 3 rpsE Small ribosomal subunit protein uS5 Aeromonas salmonicida (strain A449)
Q6LV99 2.04e-94 273 83 0 162 3 rpsE Small ribosomal subunit protein uS5 Photobacterium profundum (strain SS9)
A0KF38 3.03e-94 273 81 0 166 3 rpsE Small ribosomal subunit protein uS5 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
B7VLE0 3.53e-94 273 83 0 164 3 rpsE Small ribosomal subunit protein uS5 Vibrio atlanticus (strain LGP32)
B5FG26 5.3e-94 272 83 0 164 3 rpsE Small ribosomal subunit protein uS5 Aliivibrio fischeri (strain MJ11)
Q5E897 5.3e-94 272 83 0 164 3 rpsE Small ribosomal subunit protein uS5 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q7MPH1 7.21e-94 272 84 0 158 3 rpsE Small ribosomal subunit protein uS5 Vibrio vulnificus (strain YJ016)
Q8DE57 7.21e-94 272 84 0 158 3 rpsE Small ribosomal subunit protein uS5 Vibrio vulnificus (strain CMCP6)
C4L7U7 7.87e-94 272 83 0 166 3 rpsE Small ribosomal subunit protein uS5 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
P46183 1.73e-93 271 83 0 166 3 rpsE Small ribosomal subunit protein uS5 Buchnera aphidicola subsp. Acyrthosiphon kondoi
A1T0C5 1.73e-93 271 79 0 166 3 rpsE Small ribosomal subunit protein uS5 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B6EPU2 2.28e-93 271 82 0 164 3 rpsE Small ribosomal subunit protein uS5 Aliivibrio salmonicida (strain LFI1238)
C3LRP1 3.82e-93 270 84 0 158 3 rpsE Small ribosomal subunit protein uS5 Vibrio cholerae serotype O1 (strain M66-2)
Q9KP01 3.82e-93 270 84 0 158 3 rpsE Small ribosomal subunit protein uS5 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F563 3.82e-93 270 84 0 158 3 rpsE Small ribosomal subunit protein uS5 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q493J1 1.3e-92 269 77 0 166 3 rpsE Small ribosomal subunit protein uS5 Blochmanniella pennsylvanica (strain BPEN)
Q0I088 1.98e-92 268 80 1 167 3 rpsE Small ribosomal subunit protein uS5 Shewanella sp. (strain MR-7)
Q0HNS0 1.98e-92 268 80 1 167 3 rpsE Small ribosomal subunit protein uS5 Shewanella sp. (strain MR-4)
A0KRP1 1.98e-92 268 80 1 167 3 rpsE Small ribosomal subunit protein uS5 Shewanella sp. (strain ANA-3)
P59124 1.98e-92 268 80 1 167 3 rpsE Small ribosomal subunit protein uS5 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A1RED1 2.9e-92 268 80 1 167 3 rpsE Small ribosomal subunit protein uS5 Shewanella sp. (strain W3-18-1)
A4YBW6 2.9e-92 268 80 1 167 3 rpsE Small ribosomal subunit protein uS5 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q089N7 1.62e-91 266 79 1 167 3 rpsE Small ribosomal subunit protein uS5 Shewanella frigidimarina (strain NCIMB 400)
Q12SU2 1.62e-91 266 79 1 167 3 rpsE Small ribosomal subunit protein uS5 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B4RT45 3.13e-91 265 81 0 166 3 rpsE Small ribosomal subunit protein uS5 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q8K966 3.39e-91 265 79 1 167 3 rpsE Small ribosomal subunit protein uS5 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q15X56 3.86e-91 265 79 1 167 3 rpsE Small ribosomal subunit protein uS5 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q5QXW2 4.55e-91 265 80 0 166 3 rpsE Small ribosomal subunit protein uS5 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A9KWB9 2.38e-90 263 79 1 167 3 rpsE Small ribosomal subunit protein uS5 Shewanella baltica (strain OS195)
A6WHU5 2.38e-90 263 79 1 167 3 rpsE Small ribosomal subunit protein uS5 Shewanella baltica (strain OS185)
A3DA55 2.38e-90 263 79 1 167 3 rpsE Small ribosomal subunit protein uS5 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBI8 2.38e-90 263 79 1 167 3 rpsE Small ribosomal subunit protein uS5 Shewanella baltica (strain OS223)
A3Q999 3.99e-90 263 79 1 167 3 rpsE Small ribosomal subunit protein uS5 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
P57574 4.12e-89 260 77 1 167 3 rpsE Small ribosomal subunit protein uS5 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q3IJK2 1.79e-87 256 76 1 168 3 rpsE Small ribosomal subunit protein uS5 Pseudoalteromonas translucida (strain TAC 125)
Q89A82 1.11e-86 254 79 0 158 3 rpsE Small ribosomal subunit protein uS5 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A1TYL4 1.46e-84 248 74 0 166 3 rpsE Small ribosomal subunit protein uS5 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q488Z6 2.99e-84 248 78 0 160 3 rpsE Small ribosomal subunit protein uS5 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q2S929 4.68e-84 247 74 1 167 3 rpsE Small ribosomal subunit protein uS5 Hahella chejuensis (strain KCTC 2396)
Q8D1Z5 4.83e-83 244 72 0 166 3 rpsE Small ribosomal subunit protein uS5 Wigglesworthia glossinidia brevipalpis
Q1R0F8 1.49e-82 243 72 0 166 3 rpsE Small ribosomal subunit protein uS5 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q7VQD1 1.25e-81 241 76 1 157 3 rpsE Small ribosomal subunit protein uS5 Blochmanniella floridana
Q0VSI6 2.05e-81 241 73 1 165 3 rpsE Small ribosomal subunit protein uS5 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
C1DKN0 1.81e-80 238 74 1 166 3 rpsE Small ribosomal subunit protein uS5 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A4XZ73 1.85e-80 238 77 0 153 3 rpsE Small ribosomal subunit protein uS5 Pseudomonas mendocina (strain ymp)
Q1QDG9 4.28e-80 237 72 0 161 3 rpsE Small ribosomal subunit protein uS5 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FUD9 4.28e-80 237 72 0 161 3 rpsE Small ribosomal subunit protein uS5 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q9HWF2 5.03e-80 237 74 1 166 1 rpsE Small ribosomal subunit protein uS5 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02T63 5.03e-80 237 74 1 166 3 rpsE Small ribosomal subunit protein uS5 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V661 5.03e-80 237 74 1 166 3 rpsE Small ribosomal subunit protein uS5 Pseudomonas aeruginosa (strain LESB58)
A6UZK5 5.03e-80 237 74 1 166 3 rpsE Small ribosomal subunit protein uS5 Pseudomonas aeruginosa (strain PA7)
A5WCK7 8.78e-80 236 72 1 166 3 rpsE Small ribosomal subunit protein uS5 Psychrobacter sp. (strain PRwf-1)
Q057C1 2.33e-79 235 71 1 163 3 rpsE Small ribosomal subunit protein uS5 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
B0V6W2 3.3e-78 232 74 1 166 3 rpsE Small ribosomal subunit protein uS5 Acinetobacter baumannii (strain AYE)
B0VQT5 3.3e-78 232 74 1 166 3 rpsE Small ribosomal subunit protein uS5 Acinetobacter baumannii (strain SDF)
B2HZ91 3.3e-78 232 74 1 166 3 rpsE Small ribosomal subunit protein uS5 Acinetobacter baumannii (strain ACICU)
B7IA22 3.3e-78 232 74 1 166 1 rpsE Small ribosomal subunit protein uS5 Acinetobacter baumannii (strain AB0057)
B7GW19 3.3e-78 232 74 1 166 3 rpsE Small ribosomal subunit protein uS5 Acinetobacter baumannii (strain AB307-0294)
A3M967 4.69e-78 232 73 0 166 3 rpsE Small ribosomal subunit protein uS5 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
Q4K550 7.43e-78 231 75 0 153 3 rpsE Small ribosomal subunit protein uS5 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q48D53 2.25e-77 230 71 0 163 3 rpsE Small ribosomal subunit protein uS5 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4ZMR1 2.35e-77 230 71 0 163 3 rpsE Small ribosomal subunit protein uS5 Pseudomonas syringae pv. syringae (strain B728a)
Q889V4 2.35e-77 230 71 0 163 3 rpsE Small ribosomal subunit protein uS5 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A4VHP7 3.68e-77 230 70 1 165 3 rpsE Small ribosomal subunit protein uS5 Stutzerimonas stutzeri (strain A1501)
B1JAJ5 5.64e-77 229 75 0 153 3 rpsE Small ribosomal subunit protein uS5 Pseudomonas putida (strain W619)
Q88QL8 5.64e-77 229 75 0 153 3 rpsE Small ribosomal subunit protein uS5 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KK84 5.64e-77 229 75 0 153 3 rpsE Small ribosomal subunit protein uS5 Pseudomonas putida (strain GB-1)
A5VXR4 5.64e-77 229 75 0 153 3 rpsE Small ribosomal subunit protein uS5 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q6F7S9 1.3e-76 228 72 1 166 3 rpsE Small ribosomal subunit protein uS5 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q1IFU9 1.46e-76 228 74 0 153 3 rpsE Small ribosomal subunit protein uS5 Pseudomonas entomophila (strain L48)
Q5GWV1 2.04e-76 228 71 0 160 3 rpsE Small ribosomal subunit protein uS5 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SQS7 2.04e-76 228 71 0 160 3 rpsE Small ribosomal subunit protein uS5 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P002 2.04e-76 228 71 0 160 3 rpsE Small ribosomal subunit protein uS5 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BWW6 2.04e-76 228 71 0 160 3 rpsE Small ribosomal subunit protein uS5 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
P66587 2.04e-76 228 71 0 160 3 rpsE Small ribosomal subunit protein uS5 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RU65 2.04e-76 228 71 0 160 3 rpsE Small ribosomal subunit protein uS5 Xanthomonas campestris pv. campestris (strain B100)
Q4URF6 2.04e-76 228 71 0 160 3 rpsE Small ribosomal subunit protein uS5 Xanthomonas campestris pv. campestris (strain 8004)
P66586 2.04e-76 228 71 0 160 3 rpsE Small ribosomal subunit protein uS5 Xanthomonas axonopodis pv. citri (strain 306)
Q3K605 6.14e-76 226 75 0 152 3 rpsE Small ribosomal subunit protein uS5 Pseudomonas fluorescens (strain Pf0-1)
C3K2V9 9.01e-76 226 73 0 153 3 rpsE Small ribosomal subunit protein uS5 Pseudomonas fluorescens (strain SBW25)
B4SKY0 1.18e-75 226 70 0 160 3 rpsE Small ribosomal subunit protein uS5 Stenotrophomonas maltophilia (strain R551-3)
B2FQK1 1.36e-75 226 72 0 152 3 rpsE Small ribosomal subunit protein uS5 Stenotrophomonas maltophilia (strain K279a)
A1WVA5 1e-74 224 70 1 167 3 rpsE Small ribosomal subunit protein uS5 Halorhodospira halophila (strain DSM 244 / SL1)
Q0ABF8 3.1e-74 222 67 0 166 3 rpsE Small ribosomal subunit protein uS5 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q605C9 3.35e-74 222 68 1 169 3 rpsE Small ribosomal subunit protein uS5 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q87E65 1.52e-73 221 68 0 160 3 rpsE Small ribosomal subunit protein uS5 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I8I6 1.52e-73 221 68 0 160 3 rpsE Small ribosomal subunit protein uS5 Xylella fastidiosa (strain M23)
A4IZR7 5.34e-73 219 67 0 166 3 rpsE Small ribosomal subunit protein uS5 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NHV1 5.34e-73 219 67 0 166 3 rpsE Small ribosomal subunit protein uS5 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q0BNR0 5.34e-73 219 67 0 166 3 rpsE Small ribosomal subunit protein uS5 Francisella tularensis subsp. holarctica (strain OSU18)
A0Q4K0 5.34e-73 219 67 0 166 3 rpsE Small ribosomal subunit protein uS5 Francisella tularensis subsp. novicida (strain U112)
A7N9U2 5.34e-73 219 67 0 166 3 rpsE Small ribosomal subunit protein uS5 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
Q14JA3 5.34e-73 219 67 0 166 3 rpsE Small ribosomal subunit protein uS5 Francisella tularensis subsp. tularensis (strain FSC 198)
Q2A5F3 7.67e-73 219 67 0 166 3 rpsE Small ribosomal subunit protein uS5 Francisella tularensis subsp. holarctica (strain LVS)
B0U5L6 8.57e-73 219 67 0 160 3 rpsE Small ribosomal subunit protein uS5 Xylella fastidiosa (strain M12)
Q9PE59 3.44e-72 218 68 0 157 3 rpsE Small ribosomal subunit protein uS5 Xylella fastidiosa (strain 9a5c)
Q31IW5 3.39e-71 215 64 1 168 3 rpsE Small ribosomal subunit protein uS5 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q2L266 2.38e-70 213 68 0 156 3 rpsE Small ribosomal subunit protein uS5 Bordetella avium (strain 197N)
Q46WG1 9.66e-70 211 65 0 156 3 rpsE Small ribosomal subunit protein uS5 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q63Q28 1.13e-69 211 67 0 156 3 rpsE Small ribosomal subunit protein uS5 Burkholderia pseudomallei (strain K96243)
A3NEG2 1.13e-69 211 67 0 156 3 rpsE Small ribosomal subunit protein uS5 Burkholderia pseudomallei (strain 668)
Q3JMT0 1.13e-69 211 67 0 156 3 rpsE Small ribosomal subunit protein uS5 Burkholderia pseudomallei (strain 1710b)
A3P096 1.13e-69 211 67 0 156 3 rpsE Small ribosomal subunit protein uS5 Burkholderia pseudomallei (strain 1106a)
A1V886 1.13e-69 211 67 0 156 3 rpsE Small ribosomal subunit protein uS5 Burkholderia mallei (strain SAVP1)
Q62GM2 1.13e-69 211 67 0 156 3 rpsE Small ribosomal subunit protein uS5 Burkholderia mallei (strain ATCC 23344)
A2S7J3 1.13e-69 211 67 0 156 3 rpsE Small ribosomal subunit protein uS5 Burkholderia mallei (strain NCTC 10229)
A3MRX1 1.13e-69 211 67 0 156 3 rpsE Small ribosomal subunit protein uS5 Burkholderia mallei (strain NCTC 10247)
A9ADL0 1.13e-69 211 67 0 156 3 rpsE Small ribosomal subunit protein uS5 Burkholderia multivorans (strain ATCC 17616 / 249)
Q1LI54 1.5e-69 211 66 0 156 3 rpsE Small ribosomal subunit protein uS5 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q2SU44 2.17e-69 210 67 0 156 3 rpsE Small ribosomal subunit protein uS5 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
B2JI48 2.7e-69 210 66 0 156 3 rpsE Small ribosomal subunit protein uS5 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q3J8T1 3.18e-69 210 65 2 168 3 rpsE Small ribosomal subunit protein uS5 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
B3R7F1 3.22e-69 210 65 0 156 3 rpsE Small ribosomal subunit protein uS5 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0K636 3.22e-69 210 65 0 156 3 rpsE Small ribosomal subunit protein uS5 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q8XV29 3.44e-69 210 66 0 156 3 rpsE Small ribosomal subunit protein uS5 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q83EQ9 3.63e-69 209 65 0 155 3 rpsE Small ribosomal subunit protein uS5 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9IHT0 4.33e-69 209 67 0 156 3 rpsE Small ribosomal subunit protein uS5 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q82X75 5.32e-69 209 65 0 156 3 rpsE Small ribosomal subunit protein uS5 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q7VTB4 5.62e-69 209 67 0 156 3 rpsE Small ribosomal subunit protein uS5 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W2D8 5.62e-69 209 67 0 156 3 rpsE Small ribosomal subunit protein uS5 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WRA6 5.62e-69 209 67 0 156 3 rpsE Small ribosomal subunit protein uS5 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q39KF0 5.94e-69 209 66 0 156 3 rpsE Small ribosomal subunit protein uS5 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B4E5D7 5.94e-69 209 66 0 156 3 rpsE Small ribosomal subunit protein uS5 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
B2T734 6.49e-69 209 66 0 156 3 rpsE Small ribosomal subunit protein uS5 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A4SUX8 7e-69 209 63 1 166 3 rpsE Small ribosomal subunit protein uS5 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q13TI7 9.83e-69 209 66 0 156 3 rpsE Small ribosomal subunit protein uS5 Paraburkholderia xenovorans (strain LB400)
A4G9S1 1.2e-68 208 64 0 162 3 rpsE Small ribosomal subunit protein uS5 Herminiimonas arsenicoxydans
A4JAQ7 1.7e-68 208 66 0 156 3 rpsE Small ribosomal subunit protein uS5 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q1BRW5 1.7e-68 208 66 0 156 3 rpsE Small ribosomal subunit protein uS5 Burkholderia orbicola (strain AU 1054)
B1JU39 1.7e-68 208 66 0 156 3 rpsE Small ribosomal subunit protein uS5 Burkholderia orbicola (strain MC0-3)
Q0BJ29 1.7e-68 208 66 0 156 3 rpsE Small ribosomal subunit protein uS5 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
A0K3P2 1.7e-68 208 66 0 156 3 rpsE Small ribosomal subunit protein uS5 Burkholderia cenocepacia (strain HI2424)
B1YRP6 1.7e-68 208 66 0 156 3 rpsE Small ribosomal subunit protein uS5 Burkholderia ambifaria (strain MC40-6)
B2UEK2 1.94e-68 208 66 0 156 3 rpsE Small ribosomal subunit protein uS5 Ralstonia pickettii (strain 12J)
A1VJ32 2.96e-67 205 64 0 156 3 rpsE Small ribosomal subunit protein uS5 Polaromonas naphthalenivorans (strain CJ2)
A1AVL7 3.09e-67 205 64 0 152 3 rpsE Small ribosomal subunit protein uS5 Ruthia magnifica subsp. Calyptogena magnifica
A6T3I7 3.68e-67 204 65 0 156 3 rpsE Small ribosomal subunit protein uS5 Janthinobacterium sp. (strain Marseille)
Q5WZJ5 1.4e-66 203 62 0 154 3 rpsE Small ribosomal subunit protein uS5 Legionella pneumophila (strain Lens)
Q5ZYM6 1.4e-66 203 62 0 154 3 rpsE Small ribosomal subunit protein uS5 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IHP7 1.4e-66 203 62 0 154 3 rpsE Small ribosomal subunit protein uS5 Legionella pneumophila (strain Corby)
Q5X842 1.4e-66 203 62 0 154 3 rpsE Small ribosomal subunit protein uS5 Legionella pneumophila (strain Paris)
Q21QP0 2.55e-66 202 62 0 155 3 rpsE Small ribosomal subunit protein uS5 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A1W325 3.14e-66 202 62 0 161 3 rpsE Small ribosomal subunit protein uS5 Acidovorax sp. (strain JS42)
B9MBV4 3.14e-66 202 62 0 161 3 rpsE Small ribosomal subunit protein uS5 Acidovorax ebreus (strain TPSY)
Q12G86 3.91e-66 202 64 0 156 3 rpsE Small ribosomal subunit protein uS5 Polaromonas sp. (strain JS666 / ATCC BAA-500)
A1TJT4 9.48e-66 201 61 0 161 3 rpsE Small ribosomal subunit protein uS5 Paracidovorax citrulli (strain AAC00-1)
A1KRJ0 1.11e-65 201 58 0 163 3 rpsE Small ribosomal subunit protein uS5 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P66577 1.11e-65 201 58 0 163 3 rpsE Small ribosomal subunit protein uS5 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66576 1.11e-65 201 58 0 163 3 rpsE Small ribosomal subunit protein uS5 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M3U9 1.11e-65 201 58 0 163 3 rpsE Small ribosomal subunit protein uS5 Neisseria meningitidis serogroup C (strain 053442)
Q5F5U4 1.11e-65 201 58 0 163 3 rpsE Small ribosomal subunit protein uS5 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q47J86 1.91e-65 200 61 0 162 3 rpsE Small ribosomal subunit protein uS5 Dechloromonas aromatica (strain RCB)
A9BRW8 2.15e-65 200 63 0 155 3 rpsE Small ribosomal subunit protein uS5 Delftia acidovorans (strain DSM 14801 / SPH-1)
B5ELZ6 2.37e-65 200 63 1 157 3 rpsE Small ribosomal subunit protein uS5 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J484 2.37e-65 200 63 1 157 3 rpsE Small ribosomal subunit protein uS5 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
A5EXA1 3.62e-64 197 66 0 160 3 rpsE Small ribosomal subunit protein uS5 Dichelobacter nodosus (strain VCS1703A)
A1WK99 6.68e-64 196 63 0 155 3 rpsE Small ribosomal subunit protein uS5 Verminephrobacter eiseniae (strain EF01-2)
Q1H4M0 1.42e-63 195 67 1 169 3 rpsE Small ribosomal subunit protein uS5 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
A5CXM1 2.6e-63 195 62 0 154 3 rpsE Small ribosomal subunit protein uS5 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q0AIH9 1.83e-62 193 64 0 162 3 rpsE Small ribosomal subunit protein uS5 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
C5CQ83 4.5e-62 192 61 0 155 3 rpsE Small ribosomal subunit protein uS5 Variovorax paradoxus (strain S110)
A2SLE0 7.53e-62 191 61 0 155 3 rpsE Small ribosomal subunit protein uS5 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q2YAY0 1.56e-61 191 67 0 156 3 rpsE Small ribosomal subunit protein uS5 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q3SLN2 7.74e-61 189 65 0 162 3 rpsE Small ribosomal subunit protein uS5 Thiobacillus denitrificans (strain ATCC 25259)
Q5WLP5 1.73e-59 185 56 0 166 3 rpsE Small ribosomal subunit protein uS5 Shouchella clausii (strain KSM-K16)
B1Y8C0 2.76e-59 185 58 0 155 3 rpsE Small ribosomal subunit protein uS5 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A7HWS8 7.76e-59 184 59 1 163 3 rpsE Small ribosomal subunit protein uS5 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
C3PL26 2.58e-58 183 56 0 162 3 rpsE Small ribosomal subunit protein uS5 Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
Q8NSX5 3.6e-58 183 58 0 152 3 rpsE Small ribosomal subunit protein uS5 Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A4QBL3 3.6e-58 183 58 0 152 3 rpsE Small ribosomal subunit protein uS5 Corynebacterium glutamicum (strain R)
C4LL09 4.33e-58 183 60 0 152 3 rpsE Small ribosomal subunit protein uS5 Corynebacterium kroppenstedtii (strain DSM 44385 / JCM 11950 / CIP 105744 / CCUG 35717)
Q9Z9J7 5.92e-58 181 55 0 166 3 rpsE Small ribosomal subunit protein uS5 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A4J128 6.75e-58 181 54 0 166 3 rpsE Small ribosomal subunit protein uS5 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q8FS52 2.62e-57 181 58 0 152 3 rpsE Small ribosomal subunit protein uS5 Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q4JT86 5.36e-57 180 55 0 160 3 rpsE Small ribosomal subunit protein uS5 Corynebacterium jeikeium (strain K411)
A8LM74 6.71e-57 179 58 1 157 3 rpsE Small ribosomal subunit protein uS5 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q81J25 6.77e-57 178 54 0 166 3 rpsE Small ribosomal subunit protein uS5 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
A0R8J7 6.77e-57 178 54 0 166 3 rpsE Small ribosomal subunit protein uS5 Bacillus thuringiensis (strain Al Hakam)
Q6HPP1 7.08e-57 178 54 0 166 3 rpsE Small ribosomal subunit protein uS5 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q63H73 7.08e-57 178 54 0 166 3 rpsE Small ribosomal subunit protein uS5 Bacillus cereus (strain ZK / E33L)
Q73F79 7.08e-57 178 54 0 166 3 rpsE Small ribosomal subunit protein uS5 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q81VR3 7.08e-57 178 54 0 166 3 rpsE Small ribosomal subunit protein uS5 Bacillus anthracis
B7GJ84 7.32e-57 178 54 0 166 3 rpsE Small ribosomal subunit protein uS5 Anoxybacillus flavithermus (strain DSM 21510 / WK1)
B1VEX2 8.2e-57 180 59 0 152 3 rpsE Small ribosomal subunit protein uS5 Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109)
Q6A6P3 1.18e-56 179 59 0 155 1 rpsE Small ribosomal subunit protein uS5 Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q839E7 1.22e-56 178 54 0 166 1 rpsE Small ribosomal subunit protein uS5 Enterococcus faecalis (strain ATCC 700802 / V583)
Q28UT7 1.79e-56 178 58 1 157 3 rpsE Small ribosomal subunit protein uS5 Jannaschia sp. (strain CCS1)
P9WH33 1.89e-56 179 59 0 152 1 rpsE Small ribosomal subunit protein uS5 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WH32 1.89e-56 179 59 0 152 3 rpsE Small ribosomal subunit protein uS5 Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U0A7 1.89e-56 179 59 0 152 3 rpsE Small ribosomal subunit protein uS5 Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AL55 1.89e-56 179 59 0 152 3 rpsE Small ribosomal subunit protein uS5 Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KGK2 1.89e-56 179 59 0 152 3 rpsE Small ribosomal subunit protein uS5 Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P66575 1.89e-56 179 59 0 152 3 rpsE Small ribosomal subunit protein uS5 Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A5D5H1 1.96e-56 177 56 0 166 3 rpsE Small ribosomal subunit protein uS5 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
B2HCT8 2.21e-56 179 59 0 152 3 rpsE Small ribosomal subunit protein uS5 Mycobacterium marinum (strain ATCC BAA-535 / M)
Q5LW41 3.17e-56 177 57 1 159 3 rpsE Small ribosomal subunit protein uS5 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q73S92 3.49e-56 179 59 0 152 3 rpsE Small ribosomal subunit protein uS5 Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q6NJ85 3.53e-56 178 58 0 152 3 rpsE Small ribosomal subunit protein uS5 Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
B0TC73 3.81e-56 176 54 0 166 3 rpsE Small ribosomal subunit protein uS5 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
A8F9A2 4.02e-56 176 53 0 166 3 rpsE Small ribosomal subunit protein uS5 Bacillus pumilus (strain SAFR-032)
A7GK37 4.54e-56 176 53 0 166 3 rpsE Small ribosomal subunit protein uS5 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
P21467 4.74e-56 176 54 0 166 1 rpsE Small ribosomal subunit protein uS5 Bacillus subtilis (strain 168)
A7Z0Q5 5.7e-56 176 54 0 166 3 rpsE Small ribosomal subunit protein uS5 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
A0PM82 5.82e-56 178 58 0 152 3 rpsE Small ribosomal subunit protein uS5 Mycobacterium ulcerans (strain Agy99)
Q6AP53 6.98e-56 176 55 0 155 3 rpsE Small ribosomal subunit protein uS5 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
A4TED4 7.27e-56 177 59 0 152 3 rpsE Small ribosomal subunit protein uS5 Mycolicibacterium gilvum (strain PYR-GCK)
Q16AC7 7.65e-56 177 56 1 160 3 rpsE Small ribosomal subunit protein uS5 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
B8G1Y3 8.28e-56 176 56 0 166 3 rpsE Small ribosomal subunit protein uS5 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
B1MGC5 1e-55 177 57 0 152 3 rpsE Small ribosomal subunit protein uS5 Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CCUG 20993 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543 / L948)
A4WVJ1 1.36e-55 176 57 1 157 3 rpsE Small ribosomal subunit protein uS5 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q49ZF1 1.42e-55 175 54 0 159 3 rpsE Small ribosomal subunit protein uS5 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q5Z1Q5 1.63e-55 177 57 0 152 3 rpsE Small ribosomal subunit protein uS5 Nocardia farcinica (strain IFM 10152)
B9DM30 1.76e-55 175 53 0 164 3 rpsE Small ribosomal subunit protein uS5 Staphylococcus carnosus (strain TM300)
C5D3T4 1.84e-55 175 53 0 166 3 rpsE Small ribosomal subunit protein uS5 Geobacillus sp. (strain WCH70)
Q65P90 1.87e-55 175 53 0 166 3 rpsE Small ribosomal subunit protein uS5 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q47LL0 2.08e-55 176 56 0 153 3 rpsE Small ribosomal subunit protein uS5 Thermobifida fusca (strain YX)
Q7NQG9 2.22e-55 175 57 0 163 3 rpsE Small ribosomal subunit protein uS5 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q250L5 3.35e-55 174 56 0 166 3 rpsE Small ribosomal subunit protein uS5 Desulfitobacterium hafniense (strain Y51)
B9KLA8 3.4e-55 175 57 1 157 3 rpsE Small ribosomal subunit protein uS5 Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q3J5Q5 3.4e-55 175 57 1 157 3 rpsE Small ribosomal subunit protein uS5 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PGM8 3.4e-55 175 57 1 157 3 rpsE Small ribosomal subunit protein uS5 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A1KB10 3.7e-55 174 60 0 162 3 rpsE Small ribosomal subunit protein uS5 Azoarcus sp. (strain BH72)
A4IJK5 3.82e-55 174 53 0 166 3 rpsE Small ribosomal subunit protein uS5 Geobacillus thermodenitrificans (strain NG80-2)
C0ZW43 3.84e-55 176 56 0 155 3 rpsE Small ribosomal subunit protein uS5 Rhodococcus erythropolis (strain PR4 / NBRC 100887)
C1B029 4.34e-55 176 56 0 152 3 rpsE Small ribosomal subunit protein uS5 Rhodococcus opacus (strain B4)
Q0S3F9 4.34e-55 176 56 0 152 3 rpsE Small ribosomal subunit protein uS5 Rhodococcus jostii (strain RHA1)
Q1GK12 5.15e-55 174 56 1 157 3 rpsE Small ribosomal subunit protein uS5 Ruegeria sp. (strain TM1040)
Q5L3S2 5.54e-55 174 53 0 166 3 rpsE Small ribosomal subunit protein uS5 Geobacillus kaustophilus (strain HTA426)
A0QSG6 5.94e-55 175 57 0 152 1 rpsE Small ribosomal subunit protein uS5 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
C1DAT4 7.48e-55 173 61 0 163 3 rpsE Small ribosomal subunit protein uS5 Laribacter hongkongensis (strain HLHK9)
P59123 7.94e-55 173 52 0 164 3 rpsE Small ribosomal subunit protein uS5 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
A1B044 8.4e-55 174 57 1 157 3 rpsE Small ribosomal subunit protein uS5 Paracoccus denitrificans (strain Pd 1222)
P02357 1.01e-54 173 53 0 166 1 rpsE Small ribosomal subunit protein uS5 Geobacillus stearothermophilus
O33000 1.22e-54 174 58 0 150 3 rpsE Small ribosomal subunit protein uS5 Mycobacterium leprae (strain TN)
B8ZSA2 1.22e-54 174 58 0 150 3 rpsE Small ribosomal subunit protein uS5 Mycobacterium leprae (strain Br4923)
A1SNK1 1.23e-54 174 56 0 152 3 rpsE Small ribosomal subunit protein uS5 Nocardioides sp. (strain ATCC BAA-499 / JS614)
Q2W2K8 1.43e-54 174 56 1 163 3 rpsE Small ribosomal subunit protein uS5 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q5P315 1.53e-54 172 63 0 156 3 rpsE Small ribosomal subunit protein uS5 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A0LRN7 1.73e-54 173 57 0 152 3 rpsE Small ribosomal subunit protein uS5 Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B)
Q2LQC0 2.8e-54 172 53 1 162 3 rpsE Small ribosomal subunit protein uS5 Syntrophus aciditrophicus (strain SB)
B1HMW3 3.04e-54 172 54 1 167 3 rpsE Small ribosomal subunit protein uS5 Lysinibacillus sphaericus (strain C3-41)
P59122 3.23e-54 174 54 0 155 3 rpsE Small ribosomal subunit protein uS5 Bifidobacterium longum (strain NCC 2705)
B7GNC3 4.19e-54 174 54 0 155 3 rpsE Small ribosomal subunit protein uS5 Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)
B3DQD1 4.19e-54 174 54 0 155 3 rpsE Small ribosomal subunit protein uS5 Bifidobacterium longum (strain DJO10A)
A1A086 4.65e-54 174 55 0 155 3 rpsE Small ribosomal subunit protein uS5 Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a)
Q055C7 5.6e-54 171 46 0 166 3 rpsE1 Small ribosomal subunit protein uS5 Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04PV5 5.6e-54 171 46 0 166 3 rpsE Small ribosomal subunit protein uS5 Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q0BYD1 6.18e-54 172 53 1 163 3 rpsE Small ribosomal subunit protein uS5 Hyphomonas neptunium (strain ATCC 15444)
Q9XD19 7.6e-54 171 46 0 166 3 rpsE Small ribosomal subunit protein uS5 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72NH8 7.6e-54 171 46 0 166 3 rpsE Small ribosomal subunit protein uS5 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q67JW0 9.08e-54 171 54 0 166 3 rpsE Small ribosomal subunit protein uS5 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q0ANR7 1.21e-53 171 54 1 162 3 rpsE Small ribosomal subunit protein uS5 Maricaulis maris (strain MCS10)
Q3A9T3 1.58e-53 170 53 0 165 3 rpsE Small ribosomal subunit protein uS5 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q07KN5 1.7e-53 171 55 1 154 3 rpsE Small ribosomal subunit protein uS5 Rhodopseudomonas palustris (strain BisA53)
A1USR1 1.94e-53 171 57 1 151 3 rpsE Small ribosomal subunit protein uS5 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q8UE35 2.17e-53 170 56 1 155 3 rpsE Small ribosomal subunit protein uS5 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q211G5 2.21e-53 170 55 1 154 3 rpsE Small ribosomal subunit protein uS5 Rhodopseudomonas palustris (strain BisB18)
B8H4F1 3.23e-53 170 56 1 163 3 rpsE Small ribosomal subunit protein uS5 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A8T6 3.23e-53 170 56 1 163 3 rpsE Small ribosomal subunit protein uS5 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B4R8N4 3.38e-53 170 55 1 163 3 rpsE Small ribosomal subunit protein uS5 Phenylobacterium zucineum (strain HLK1)
A0ALV1 3.67e-53 169 52 0 164 3 rpsE Small ribosomal subunit protein uS5 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q8Y446 3.67e-53 169 52 0 164 1 rpsE Small ribosomal subunit protein uS5 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q71WG3 3.67e-53 169 52 0 164 3 rpsE Small ribosomal subunit protein uS5 Listeria monocytogenes serotype 4b (strain F2365)
Q134U6 4.06e-53 170 56 1 153 3 rpsE Small ribosomal subunit protein uS5 Rhodopseudomonas palustris (strain BisB5)
Q7MTN0 4.43e-53 169 53 0 156 3 rpsE Small ribosomal subunit protein uS5 Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
A0LIK7 5.1e-53 169 52 0 164 3 rpsE Small ribosomal subunit protein uS5 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q927M4 5.44e-53 169 52 0 164 3 rpsE Small ribosomal subunit protein uS5 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q1QN13 5.52e-53 169 56 1 149 3 rpsE Small ribosomal subunit protein uS5 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A8LB15 5.75e-53 170 54 0 152 3 rpsE Small ribosomal subunit protein uS5 Parafrankia sp. (strain EAN1pec)
A8IAP6 5.76e-53 169 54 1 161 3 rpsE Small ribosomal subunit protein uS5 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
B9JVQ4 6.04e-53 169 56 1 155 3 rpsE Small ribosomal subunit protein uS5 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q0RRQ4 6.07e-53 169 54 0 152 3 rpsE Small ribosomal subunit protein uS5 Frankia alni (strain DSM 45986 / CECT 9034 / ACN14a)
C3MAZ7 6.17e-53 169 56 1 155 3 rpsE Small ribosomal subunit protein uS5 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A6U876 6.38e-53 169 56 1 155 3 rpsE Small ribosomal subunit protein uS5 Sinorhizobium medicae (strain WSM419)
Q92QF3 6.38e-53 169 56 1 155 3 rpsE Small ribosomal subunit protein uS5 Rhizobium meliloti (strain 1021)
Q2JFF9 6.41e-53 169 54 0 152 3 rpsE Small ribosomal subunit protein uS5 Frankia casuarinae (strain DSM 45818 / CECT 9043 / HFP020203 / CcI3)
P66580 6.56e-53 168 56 0 150 3 rpsE Small ribosomal subunit protein uS5 Staphylococcus aureus (strain MW2)
A8Z340 6.56e-53 168 56 0 150 3 rpsE Small ribosomal subunit protein uS5 Staphylococcus aureus (strain USA300 / TCH1516)
Q6G788 6.56e-53 168 56 0 150 3 rpsE Small ribosomal subunit protein uS5 Staphylococcus aureus (strain MSSA476)
Q6GEK0 6.56e-53 168 56 0 150 3 rpsE Small ribosomal subunit protein uS5 Staphylococcus aureus (strain MRSA252)
P66579 6.56e-53 168 56 0 150 1 rpsE Small ribosomal subunit protein uS5 Staphylococcus aureus (strain N315)
P66578 6.56e-53 168 56 0 150 3 rpsE Small ribosomal subunit protein uS5 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q5HDX5 6.56e-53 168 56 0 150 3 rpsE Small ribosomal subunit protein uS5 Staphylococcus aureus (strain COL)
Q2YYL4 6.56e-53 168 56 0 150 1 rpsE Small ribosomal subunit protein uS5 Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IV17 6.56e-53 168 56 0 150 3 rpsE Small ribosomal subunit protein uS5 Staphylococcus aureus (strain JH9)
Q2FW23 6.56e-53 168 56 0 150 1 rpsE Small ribosomal subunit protein uS5 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FEQ6 6.56e-53 168 56 0 150 3 rpsE Small ribosomal subunit protein uS5 Staphylococcus aureus (strain USA300)
A6U3V8 6.56e-53 168 56 0 150 3 rpsE Small ribosomal subunit protein uS5 Staphylococcus aureus (strain JH1)
A7X5D8 6.56e-53 168 56 0 150 3 rpsE Small ribosomal subunit protein uS5 Staphylococcus aureus (strain Mu3 / ATCC 700698)
B3QBW3 6.85e-53 169 56 1 153 3 rpsE Small ribosomal subunit protein uS5 Rhodopseudomonas palustris (strain TIE-1)
Q6N4V0 6.85e-53 169 56 1 153 1 rpsE Small ribosomal subunit protein uS5 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q2IXP3 7.56e-53 169 56 1 153 3 rpsE Small ribosomal subunit protein uS5 Rhodopseudomonas palustris (strain HaA2)
Q89JA1 8.79e-53 169 57 1 149 3 rpsE Small ribosomal subunit protein uS5 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A6QJ75 9.65e-53 168 56 0 149 3 rpsE Small ribosomal subunit protein uS5 Staphylococcus aureus (strain Newman)
B1Z776 9.8e-53 169 56 1 156 3 rpsE Small ribosomal subunit protein uS5 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A9W4S3 1.01e-52 169 56 1 156 3 rpsE Small ribosomal subunit protein uS5 Methylorubrum extorquens (strain PA1)
B7L0T3 1.01e-52 169 56 1 156 3 rpsE Small ribosomal subunit protein uS5 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
A4YSK9 1.12e-52 169 55 1 154 3 rpsE Small ribosomal subunit protein uS5 Bradyrhizobium sp. (strain ORS 278)
A5ELL0 1.12e-52 169 55 1 154 3 rpsE Small ribosomal subunit protein uS5 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q8CRH7 1.13e-52 167 56 0 150 3 rpsE Small ribosomal subunit protein uS5 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HM16 1.13e-52 167 56 0 150 3 rpsE Small ribosomal subunit protein uS5 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B0T2D9 1.17e-52 169 55 1 163 3 rpsE Small ribosomal subunit protein uS5 Caulobacter sp. (strain K31)
A4VSH0 1.19e-52 167 53 0 155 3 rpsE Small ribosomal subunit protein uS5 Streptococcus suis (strain 05ZYH33)
A4VYQ9 1.19e-52 167 53 0 155 3 rpsE Small ribosomal subunit protein uS5 Streptococcus suis (strain 98HAH33)
P0DE95 1.19e-52 167 54 0 155 3 rpsE Small ribosomal subunit protein uS5 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48VT2 1.19e-52 167 54 0 155 3 rpsE Small ribosomal subunit protein uS5 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RC31 1.19e-52 167 54 0 155 3 rpsE Small ribosomal subunit protein uS5 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J8Z6 1.19e-52 167 54 0 155 3 rpsE Small ribosomal subunit protein uS5 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JJ45 1.19e-52 167 54 0 155 3 rpsE Small ribosomal subunit protein uS5 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JP00 1.19e-52 167 54 0 155 3 rpsE Small ribosomal subunit protein uS5 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JE42 1.19e-52 167 54 0 155 3 rpsE Small ribosomal subunit protein uS5 Streptococcus pyogenes serotype M12 (strain MGAS2096)
P66585 1.19e-52 167 54 0 155 3 rpsE Small ribosomal subunit protein uS5 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XEB8 1.19e-52 167 54 0 155 3 rpsE Small ribosomal subunit protein uS5 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DE94 1.19e-52 167 54 0 155 3 rpsE Small ribosomal subunit protein uS5 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P66583 1.19e-52 167 54 0 155 3 rpsE Small ribosomal subunit protein uS5 Streptococcus pyogenes serotype M1
Q30Z59 1.24e-52 167 54 0 159 3 rpsE Small ribosomal subunit protein uS5 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q0AUJ7 1.55e-52 167 51 1 166 3 rpsE Small ribosomal subunit protein uS5 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q4L897 1.81e-52 167 56 0 150 3 rpsE Small ribosomal subunit protein uS5 Staphylococcus haemolyticus (strain JCSC1435)
Q11HR9 1.81e-52 168 58 1 150 3 rpsE Small ribosomal subunit protein uS5 Chelativorans sp. (strain BNC1)
A0M581 1.95e-52 167 52 0 163 3 rpsE Small ribosomal subunit protein uS5 Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
A7IPQ3 2.04e-52 167 56 1 153 3 rpsE Small ribosomal subunit protein uS5 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
B8DW30 2.12e-52 169 53 0 155 3 rpsE Small ribosomal subunit protein uS5 Bifidobacterium animalis subsp. lactis (strain AD011)
Q3A6N0 2.55e-52 167 52 0 163 3 rpsE Small ribosomal subunit protein uS5 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
A6X0D5 2.86e-52 167 56 1 155 3 rpsE Small ribosomal subunit protein uS5 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
B8ISA2 3.09e-52 167 55 1 156 3 rpsE Small ribosomal subunit protein uS5 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
B5ZYV2 4.74e-52 167 56 1 155 3 rpsE Small ribosomal subunit protein uS5 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q2K9J9 4.74e-52 167 56 1 155 3 rpsE Small ribosomal subunit protein uS5 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PWT8 4.74e-52 167 56 1 155 3 rpsE Small ribosomal subunit protein uS5 Rhizobium etli (strain CIAT 652)
Q1MIC4 5.06e-52 167 56 1 155 3 rpsE Small ribosomal subunit protein uS5 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B8ELE6 5.06e-52 167 53 1 163 3 rpsE Small ribosomal subunit protein uS5 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
A3CK81 6.24e-52 166 54 0 155 3 rpsE Small ribosomal subunit protein uS5 Streptococcus sanguinis (strain SK36)
C6C1A2 6.67e-52 166 57 0 151 3 rpsE Small ribosomal subunit protein uS5 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
B1LWQ9 7.65e-52 167 55 1 156 3 rpsE Small ribosomal subunit protein uS5 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
A9IW04 8.39e-52 166 54 1 155 3 rpsE Small ribosomal subunit protein uS5 Bartonella tribocorum (strain CIP 105476 / IBS 506)
B0UHV2 8.87e-52 166 56 1 153 3 rpsE Small ribosomal subunit protein uS5 Methylobacterium sp. (strain 4-46)
Q97EJ5 9.13e-52 165 51 0 164 3 rpsE Small ribosomal subunit protein uS5 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q6AD11 1.16e-51 167 53 0 155 3 rpsE Small ribosomal subunit protein uS5 Leifsonia xyli subsp. xyli (strain CTCB07)
Q3SSU9 1.21e-51 166 54 1 153 3 rpsE Small ribosomal subunit protein uS5 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q98N40 1.58e-51 166 59 1 147 3 rpsE Small ribosomal subunit protein uS5 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q6FZD9 1.86e-51 165 53 1 155 3 rpsE Small ribosomal subunit protein uS5 Bartonella quintana (strain Toulouse)
Q2RFR4 1.98e-51 164 51 0 166 3 rpsE Small ribosomal subunit protein uS5 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q6G2Y2 1.99e-51 165 53 1 155 3 rpsE Small ribosomal subunit protein uS5 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A8AZK8 2.36e-51 164 53 0 155 3 rpsE Small ribosomal subunit protein uS5 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
A3DJI9 2.54e-51 164 50 0 166 3 rpsE Small ribosomal subunit protein uS5 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
B6JEY2 3.07e-51 165 55 1 149 3 rpsE Small ribosomal subunit protein uS5 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q2N9C8 3.43e-51 168 58 1 155 3 rpsE Small ribosomal subunit protein uS5 Erythrobacter litoralis (strain HTCC2594)
Q5NQ48 3.48e-51 166 53 1 163 3 rpsE Small ribosomal subunit protein uS5 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
A0JZ68 3.6e-51 166 51 0 160 3 rpsE Small ribosomal subunit protein uS5 Arthrobacter sp. (strain FB24)
A0PXW3 6.58e-51 163 51 0 163 3 rpsE Small ribosomal subunit protein uS5 Clostridium novyi (strain NT)
P66571 7.06e-51 164 57 1 147 3 rpsE Small ribosomal subunit protein uS5 Brucella suis biovar 1 (strain 1330)
B0CH15 7.06e-51 164 57 1 147 3 rpsE Small ribosomal subunit protein uS5 Brucella suis (strain ATCC 23445 / NCTC 10510)
P66570 7.06e-51 164 57 1 147 3 rpsE Small ribosomal subunit protein uS5 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RJI4 7.06e-51 164 57 1 147 3 rpsE Small ribosomal subunit protein uS5 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M5N3 7.06e-51 164 57 1 147 3 rpsE Small ribosomal subunit protein uS5 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57CS5 7.06e-51 164 57 1 147 3 rpsE Small ribosomal subunit protein uS5 Brucella abortus biovar 1 (strain 9-941)
Q2YRT3 7.06e-51 164 57 1 147 3 rpsE Small ribosomal subunit protein uS5 Brucella abortus (strain 2308)
B2S662 7.06e-51 164 57 1 147 3 rpsE Small ribosomal subunit protein uS5 Brucella abortus (strain S19)
Q18CH3 8.68e-51 163 54 0 157 3 rpsE Small ribosomal subunit protein uS5 Clostridioides difficile (strain 630)
A5VQY9 9.68e-51 163 57 1 147 3 rpsE Small ribosomal subunit protein uS5 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Q0BUN3 1.35e-50 163 54 1 160 3 rpsE Small ribosomal subunit protein uS5 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
P66582 1.39e-50 162 51 0 160 3 rpsE Small ribosomal subunit protein uS5 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P66581 1.39e-50 162 51 0 160 3 rpsE Small ribosomal subunit protein uS5 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
Q04ML9 1.39e-50 162 51 0 160 3 rpsE Small ribosomal subunit protein uS5 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
B2S2F3 3.45e-50 162 52 0 157 3 rpsE Small ribosomal subunit protein uS5 Treponema pallidum subsp. pallidum (strain SS14)
O83236 3.45e-50 162 52 0 157 3 rpsE Small ribosomal subunit protein uS5 Treponema pallidum (strain Nichols)
Q1MPP8 3.47e-50 161 54 0 150 3 rpsE Small ribosomal subunit protein uS5 Lawsonia intracellularis (strain PHE/MN1-00)
O67563 3.78e-50 162 52 0 156 3 rpsE Small ribosomal subunit protein uS5 Aquifex aeolicus (strain VF5)
Q03ED3 3.8e-50 161 50 0 161 3 rpsE Small ribosomal subunit protein uS5 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
Q2IJ66 3.87e-50 161 55 0 157 3 rpsE Small ribosomal subunit protein uS5 Anaeromyxobacter dehalogenans (strain 2CP-C)
B2IK79 3.93e-50 162 54 1 158 3 rpsE Small ribosomal subunit protein uS5 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
Q2RQX7 5.14e-50 162 54 1 157 3 rpsE Small ribosomal subunit protein uS5 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
B9MKG4 5.15e-50 161 48 0 162 3 rpsE Small ribosomal subunit protein uS5 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q8A493 7.41e-50 160 50 0 156 3 rpsE Small ribosomal subunit protein uS5 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
A4XLR3 7.8e-50 160 48 0 162 3 rpsE Small ribosomal subunit protein uS5 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q88XW9 8e-50 160 49 0 164 3 rpsE Small ribosomal subunit protein uS5 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A8Z683 1.05e-49 160 51 1 162 3 rpsE Small ribosomal subunit protein uS5 Karelsulcia muelleri (strain GWSS)
A1R8S9 1.44e-49 162 50 0 160 3 rpsE Small ribosomal subunit protein uS5 Paenarthrobacter aurescens (strain TC1)
Q03PX4 1.44e-49 160 49 0 161 3 rpsE Small ribosomal subunit protein uS5 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
A1VE99 2.29e-49 159 54 0 152 3 rpsE Small ribosomal subunit protein uS5 Nitratidesulfovibrio vulgaris (strain DP4)
Q72CG3 2.29e-49 159 54 0 152 3 rpsE Small ribosomal subunit protein uS5 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A9H3L2 3.52e-49 160 54 1 157 3 rpsE Small ribosomal subunit protein uS5 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q38US8 4.07e-49 159 49 0 164 3 rpsE Small ribosomal subunit protein uS5 Latilactobacillus sakei subsp. sakei (strain 23K)
Q0SN12 4.3e-49 159 47 1 166 3 rpsE Small ribosomal subunit protein uS5 Borreliella afzelii (strain PKo)
Q64NM5 5e-49 159 51 0 156 3 rpsE Small ribosomal subunit protein uS5 Bacteroides fragilis (strain YCH46)
Q5L8C6 5e-49 159 51 0 156 3 rpsE Small ribosomal subunit protein uS5 Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
A7HBN5 5.27e-49 158 53 0 157 3 rpsE Small ribosomal subunit protein uS5 Anaeromyxobacter sp. (strain Fw109-5)
O52349 5.41e-49 160 51 1 156 3 rpsE Small ribosomal subunit protein uS5 Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
B8DNB3 5.8e-49 158 53 0 152 3 rpsE Small ribosomal subunit protein uS5 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
A6KYH8 7.03e-49 158 51 0 156 3 rpsE Small ribosomal subunit protein uS5 Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q1ISA5 8.04e-49 158 50 3 169 3 rpsE Small ribosomal subunit protein uS5 Koribacter versatilis (strain Ellin345)
Q5FU00 1.05e-48 158 52 1 158 3 rpsE Small ribosomal subunit protein uS5 Gluconobacter oxydans (strain 621H)
A5FZU8 1.16e-48 158 53 1 157 3 rpsE Small ribosomal subunit protein uS5 Acidiphilium cryptum (strain JF-5)
Q0SQG1 1.25e-48 157 48 0 163 3 rpsE Small ribosomal subunit protein uS5 Clostridium perfringens (strain SM101 / Type A)
Q8XHU0 1.25e-48 157 48 0 163 3 rpsE Small ribosomal subunit protein uS5 Clostridium perfringens (strain 13 / Type A)
Q0TMR3 1.25e-48 157 48 0 163 3 rpsE Small ribosomal subunit protein uS5 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
A6GZ82 1.58e-48 157 50 0 156 3 rpsE Small ribosomal subunit protein uS5 Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
O51448 3.57e-48 156 47 1 166 1 rpsE Small ribosomal subunit protein uS5 Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q6MJ29 4.71e-48 155 54 1 149 3 rpsE Small ribosomal subunit protein uS5 Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
B2A4F6 6.13e-48 155 50 0 157 3 rpsE Small ribosomal subunit protein uS5 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
A1ALV8 1.08e-47 155 49 1 159 3 rpsE Small ribosomal subunit protein uS5 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q1AU46 1.09e-47 156 51 1 158 3 rpsE Small ribosomal subunit protein uS5 Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129 / PRD-1)
Q04G69 1.74e-47 154 49 0 155 3 rpsE Small ribosomal subunit protein uS5 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q7UN03 1.81e-47 155 46 0 155 3 rpsE Small ribosomal subunit protein uS5 Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q749A4 2.13e-47 154 50 1 159 3 rpsE Small ribosomal subunit protein uS5 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A5USH2 3.06e-47 154 51 0 155 3 rpsE Small ribosomal subunit protein uS5 Roseiflexus sp. (strain RS-1)
A5IYW9 3.52e-47 156 48 1 158 3 rpsE Small ribosomal subunit protein uS5 Mycoplasmopsis agalactiae (strain NCTC 10123 / CIP 59.7 / PG2)
Q661C5 3.6e-47 154 47 1 165 3 rpsE Small ribosomal subunit protein uS5 Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q1D758 3.75e-47 154 52 0 153 3 rpsE Small ribosomal subunit protein uS5 Myxococcus xanthus (strain DK1622)
B2V7J6 4.36e-47 154 52 1 155 3 rpsE Small ribosomal subunit protein uS5 Sulfurihydrogenibium sp. (strain YO3AOP1)
Q39XY9 5.74e-47 153 50 1 159 3 rpsE Small ribosomal subunit protein uS5 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
B9LJE9 6.52e-47 154 47 0 162 3 rpsE Small ribosomal subunit protein uS5 Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WH83 6.52e-47 154 47 0 162 3 rpsE Small ribosomal subunit protein uS5 Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
A5V5Y5 6.96e-47 155 53 1 163 3 rpsE Small ribosomal subunit protein uS5 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q73PL5 8.39e-47 153 50 1 164 3 rpsE Small ribosomal subunit protein uS5 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
C1CXE9 1.18e-46 153 45 0 164 3 rpsE Small ribosomal subunit protein uS5 Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
A4XBM9 1.23e-46 154 55 0 152 3 rpsE Small ribosomal subunit protein uS5 Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
A8ESW0 1.44e-46 151 51 0 139 3 rpsE Small ribosomal subunit protein uS5 Aliarcobacter butzleri (strain RM4018)
B3QYE1 1.69e-46 152 50 0 154 3 rpsE Small ribosomal subunit protein uS5 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
A6LEH4 1.7e-46 152 50 0 156 3 rpsE Small ribosomal subunit protein uS5 Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
B3E847 2.08e-46 152 47 1 159 3 rpsE Small ribosomal subunit protein uS5 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q03ZM9 2.14e-46 152 53 0 159 3 rpsE Small ribosomal subunit protein uS5 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
P66572 2.5e-46 151 48 1 149 3 rpsE Small ribosomal subunit protein uS5 Helicobacter pylori (strain ATCC 700392 / 26695)
P66573 2.5e-46 151 48 1 149 3 rpsE Small ribosomal subunit protein uS5 Helicobacter pylori (strain J99 / ATCC 700824)
Q1IX89 2.85e-46 152 49 0 154 3 rpsE Small ribosomal subunit protein uS5 Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
B2UV65 3.17e-46 151 48 1 149 3 rpsE Small ribosomal subunit protein uS5 Helicobacter pylori (strain Shi470)
Q1CRV8 3.17e-46 151 48 1 149 3 rpsE Small ribosomal subunit protein uS5 Helicobacter pylori (strain HPAG1)
B6JNE1 3.17e-46 151 48 1 149 3 rpsE Small ribosomal subunit protein uS5 Helicobacter pylori (strain P12)
A0L5Z0 4.04e-46 151 50 1 150 3 rpsE Small ribosomal subunit protein uS5 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
A6TWG5 4.64e-46 151 49 0 163 3 rpsE Small ribosomal subunit protein uS5 Alkaliphilus metalliredigens (strain QYMF)
B8G6Q8 7.89e-46 150 48 0 155 3 rpsE Small ribosomal subunit protein uS5 Chloroflexus aggregans (strain MD-66 / DSM 9485)
Q1WSA7 8.6e-46 150 51 0 164 3 rpsE Small ribosomal subunit protein uS5 Ligilactobacillus salivarius (strain UCC118)
A7GJ57 9.01e-46 150 49 0 163 3 rpsE Small ribosomal subunit protein uS5 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
A5I7I9 9.01e-46 150 49 0 163 3 rpsE Small ribosomal subunit protein uS5 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FQ40 9.01e-46 150 49 0 163 3 rpsE Small ribosomal subunit protein uS5 Clostridium botulinum (strain ATCC 19397 / Type A)
B3QR82 9.25e-46 150 47 0 154 3 rpsE Small ribosomal subunit protein uS5 Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
A0RM28 9.36e-46 149 51 0 139 3 rpsE Small ribosomal subunit protein uS5 Campylobacter fetus subsp. fetus (strain 82-40)
Q7VGC7 9.48e-46 149 50 0 140 3 rpsE Small ribosomal subunit protein uS5 Helicobacter hepaticus (strain ATCC 51449 / 3B1)
B3EP44 9.88e-46 150 48 0 155 3 rpsE Small ribosomal subunit protein uS5 Chlorobium phaeobacteroides (strain BS1)
A8M512 1.11e-45 151 54 0 152 3 rpsE Small ribosomal subunit protein uS5 Salinispora arenicola (strain CNS-205)
A4FPK8 1.25e-45 151 56 0 152 3 rpsE Small ribosomal subunit protein uS5 Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q8KAI8 1.39e-45 150 47 0 155 3 rpsE Small ribosomal subunit protein uS5 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
A7H0Z5 1.71e-45 149 51 0 140 3 rpsE Small ribosomal subunit protein uS5 Campylobacter curvus (strain 525.92)
A4SCS6 1.76e-45 150 49 0 155 3 rpsE Small ribosomal subunit protein uS5 Chlorobium phaeovibrioides (strain DSM 265 / 1930)
C0QQP0 1.83e-45 150 49 1 155 3 rpsE Small ribosomal subunit protein uS5 Persephonella marina (strain DSM 14350 / EX-H1)
Q7M8E9 1.85e-45 149 48 0 146 3 rpsE Small ribosomal subunit protein uS5 Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
Q17ZC2 2.03e-45 149 50 0 140 3 rpsE Small ribosomal subunit protein uS5 Helicobacter acinonychis (strain Sheeba)
Q3B6E5 2.19e-45 149 49 0 155 3 rpsE Small ribosomal subunit protein uS5 Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
B3EGX3 2.55e-45 149 49 0 155 3 rpsE Small ribosomal subunit protein uS5 Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q9X1J2 2.71e-45 149 50 0 146 3 rpsE Small ribosomal subunit protein uS5 Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q1GPB6 3.05e-45 151 54 1 157 3 rpsE Small ribosomal subunit protein uS5 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_18920
Feature type CDS
Gene rpsE
Product 30S ribosomal protein S5
Location 14869 - 15369 (strand: -1)
Length 501 (nucleotides) / 166 (amino acids)
In genomic island -

Contig

Accession ZDB_544
Length 24827 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2415
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00333 Ribosomal protein S5, N-terminal domain
PF03719 Ribosomal protein S5, C-terminal domain

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0098 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein S5

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02988 small subunit ribosomal protein S5 Ribosome -

Protein Sequence

MAHIEKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYGKAREVPAAIQKAMEKARRNMKTVALNNGTLFHPVKGTHTGSRVFMQPAHEGTGIIAGGAMRAVLEVAGVRNVLAKTYGSTNPINVVRATLDALDSMKSPEMVAAKRGKSVEEILG

Flanking regions ( +/- flanking 50bp)

GCAGATGCTGCCCGTGAAGCTGGCCTACAGTTCTAAGGTAGAGGTGTAAGATGGCACACATCGAAAAACAGGCTGGCGAACTGCAGGAAAAGCTGATCGCGGTAAACCGCGTATCTAAAACCGTTAAAGGTGGTCGTATCTTTAGCTTCACCGCACTGACTGTAGTGGGTGATGGCAACGGCCGCGTTGGTTTTGGTTACGGCAAAGCACGCGAAGTTCCGGCAGCAATCCAGAAAGCGATGGAAAAAGCCCGTCGCAACATGAAAACCGTTGCACTTAACAACGGCACATTATTCCACCCAGTGAAAGGCACACACACCGGTTCCCGCGTGTTTATGCAGCCTGCTCACGAAGGTACCGGTATTATTGCCGGTGGTGCAATGCGTGCTGTTCTTGAAGTTGCCGGTGTTCGTAACGTCCTGGCTAAAACTTATGGTTCCACGAACCCAATTAACGTTGTTCGTGCAACACTGGATGCTTTAGACAGCATGAAGTCTCCGGAAATGGTTGCAGCTAAGCGTGGTAAATCCGTCGAAGAAATTCTGGGGTAATGGACCATGGCTAAGACAATTAAAATTACACAAACCCGCAGCTCAATCGG