Homologs in group_2372

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_19110 FBDBKF_19110 100.0 Morganella morganii S1 zntR Zn(2+)-responsive transcriptional regulator
EHELCC_18855 EHELCC_18855 100.0 Morganella morganii S2 zntR Zn(2+)-responsive transcriptional regulator
LHKJJB_18725 LHKJJB_18725 100.0 Morganella morganii S3 zntR Zn(2+)-responsive transcriptional regulator
HKOGLL_18460 HKOGLL_18460 100.0 Morganella morganii S5 zntR Zn(2+)-responsive transcriptional regulator
F4V73_RS19055 F4V73_RS19055 93.1 Morganella psychrotolerans zntR Zn(2+)-responsive transcriptional regulator
PMI_RS16280 PMI_RS16280 78.1 Proteus mirabilis HI4320 zntR Zn(2+)-responsive transcriptional regulator

Distribution of the homologs in the orthogroup group_2372

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2372

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0ACS5 9.26e-69 207 69 0 135 1 zntR HTH-type transcriptional regulator ZntR Escherichia coli (strain K12)
P0ACS6 9.26e-69 207 69 0 135 3 zntR HTH-type transcriptional regulator ZntR Escherichia coli O157:H7
P0A9G5 1.51e-23 92 37 2 127 3 cueR HTH-type transcriptional regulator CueR Shigella flexneri
P0A9G4 1.51e-23 92 37 2 127 1 cueR HTH-type transcriptional regulator CueR Escherichia coli (strain K12)
Q8FK74 4.18e-23 91 37 2 127 3 cueR HTH-type transcriptional regulator CueR Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8XD09 5.07e-23 90 37 2 127 3 cueR HTH-type transcriptional regulator CueR Escherichia coli O157:H7
Q93CH6 1.74e-21 87 35 2 127 1 cueR HTH-type transcriptional regulator CueR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q55963 1.89e-21 87 36 1 115 4 slr0701 Uncharacterized HTH-type transcriptional regulator slr0701 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
P13111 3.76e-21 86 38 5 138 4 merR Mercuric resistance operon regulatory protein Serratia marcescens
Q8Z8S3 4.55e-21 85 34 2 127 3 cueR HTH-type transcriptional regulator CueR Salmonella typhi
P69413 1.61e-20 84 37 4 133 3 merR Mercuric resistance operon regulatory protein Pseudomonas sp.
P0A184 1.61e-20 84 37 4 133 3 merR Mercuric resistance operon regulatory protein Pseudomonas fluorescens
P0A183 1.61e-20 84 37 4 133 1 merR Mercuric resistance operon regulatory protein Pseudomonas aeruginosa
P22853 1.85e-20 84 34 2 129 1 merR1 Mercuric resistance operon regulatory protein Bacillus cereus
Q9X5X4 2.82e-20 84 34 2 131 1 hmrR HTH-type transcriptional regulator HmrR Sinorhizobium medicae (strain WSM419)
P44617 4.64e-20 83 34 2 128 3 HI_0293 Probable heavy metal-dependent transcriptional regulator HI_0293 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0A2Q9 8.64e-20 82 39 2 111 4 merR Mercuric resistance operon regulatory protein Shigella flexneri
P0A2Q8 8.64e-20 82 39 2 111 3 merR Mercuric resistance operon regulatory protein Salmonella typhi
P58379 1.33e-19 82 33 2 133 3 hmrR2 Heavy metal-dependent transcription regulator 2 Rhizobium meliloti (strain 1021)
P22896 1.94e-19 81 35 1 118 4 merR Mercuric resistance operon regulatory protein (Fragment) Acidithiobacillus ferrooxidans
Q9HV30 5.28e-18 77 33 2 130 3 PA4778 Uncharacterized HTH-type transcriptional regulator PA4778 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P58378 3.56e-17 76 31 3 132 3 hmrR1 Heavy metal-dependent transcription regulator 1 Rhizobium meliloti (strain 1021)
P22874 6.66e-17 75 31 2 132 4 merR Mercuric resistance operon regulatory protein Staphylococcus aureus
Q8ZCA8 1.49e-15 71 32 2 127 3 cueR HTH-type transcriptional regulator CueR Yersinia pestis
Q9X5V4 2.54e-15 70 32 3 131 4 hmrR HTH-type transcriptional regulator HmrR Rhizobium leguminosarum bv. viciae
P45277 4.22e-14 67 35 1 105 3 zntR HTH-type transcriptional regulator ZntR homolog Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P0C6D2 5.78e-14 67 29 2 128 3 cueR HTH-type transcriptional regulator CueR Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F2W6 5.78e-14 67 29 2 128 3 cueR HTH-type transcriptional regulator CueR Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
P50330 5.42e-10 58 25 3 144 4 nolA Nodulation protein NolA Bradyrhizobium sp. (strain NC92)
P50329 1.84e-09 57 41 0 63 4 nolA Nodulation protein NolA (Fragment) Bradyrhizobium elkanii
O06474 5.02e-09 54 44 1 63 2 yfmP HTH-type transcriptional regulator YfmP Bacillus subtilis (strain 168)
P37510 1.63e-08 53 33 0 68 4 yyaN Uncharacterized HTH-type transcriptional regulator YyaN Bacillus subtilis (strain 168)
P71039 1.92e-08 54 37 0 67 1 mta HTH-type transcriptional activator mta Bacillus subtilis (strain 168)
P0A4T9 2.55e-08 54 35 1 81 1 tipA HTH-type transcriptional activator TipA Streptomyces lividans
P0A4T8 2.55e-08 54 35 1 81 3 tipA HTH-type transcriptional activator TipA Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
P0CL12 1.35e-07 52 30 0 86 3 mlrA HTH-type transcriptional regulator MlrA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
E1WH94 1.35e-07 52 30 0 86 4 mlrA HTH-type transcriptional regulator MlrA Salmonella typhimurium (strain SL1344)
O06008 2.86e-07 50 27 0 93 1 adhR HTH-type transcriptional regulator AdhR Bacillus subtilis (strain 168)
P0ACS4 9.38e-07 48 27 5 147 3 soxR Redox-sensitive transcriptional activator SoxR Shigella flexneri
P0ACS2 9.38e-07 48 27 5 147 1 soxR Redox-sensitive transcriptional activator SoxR Escherichia coli (strain K12)
P0ACS3 9.38e-07 48 27 5 147 3 soxR Redox-sensitive transcriptional activator SoxR Escherichia coli O157:H7
P33358 2.08e-06 48 35 2 70 1 mlrA HTH-type transcriptional regulator MlrA Escherichia coli (strain K12)
P22537 3.11e-06 48 39 0 61 2 nolA Nodulation protein NolA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
P0A2R0 3.49e-06 47 28 5 125 3 soxR Redox-sensitive transcriptional activator SoxR Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2R1 3.49e-06 47 28 5 125 3 soxR Redox-sensitive transcriptional activator SoxR Salmonella typhi
P44558 7.17e-06 46 28 2 103 1 HI_0186 Uncharacterized HTH-type transcriptional regulator HI_0186 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q51506 9.9e-06 46 25 2 124 3 soxR Redox-sensitive transcriptional activator SoxR Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
P0A2Q6 1.12e-05 45 36 0 66 4 merD HTH-type transcriptional regulator MerD Salmonella typhi
P0A2Q7 1.12e-05 45 36 0 66 4 merD HTH-type transcriptional regulator MerD Enterobacter agglomerans
Q52110 1.98e-05 44 36 0 66 4 merD HTH-type transcriptional regulator MerD Acinetobacter calcoaceticus
P20102 6.91e-05 43 34 0 66 4 merD HTH-type transcriptional regulator MerD Shigella flexneri
Q9ZHI4 0.000164 42 27 3 137 4 soxR HTH-type transcriptional activator SoxR homolog Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
P06689 0.00031 41 34 0 66 4 merD HTH-type transcriptional regulator MerD Pseudomonas aeruginosa
P08654 0.000497 40 29 2 106 4 merD HTH-type transcriptional regulator MerD Serratia marcescens

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_18870
Feature type CDS
Gene zntR
Product Zn(2+)-responsive transcriptional regulator
Location 9140 - 9589 (strand: -1)
Length 450 (nucleotides) / 149 (amino acids)

Contig

Accession ZDB_544
Length 24827 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2372
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF13411 MerR HTH family regulatory protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0789 Transcription (K) K DNA-binding transcriptional regulator, MerR family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K13638 MerR family transcriptional regulator, Zn(II)-responsive regulator of zntA - -

Protein Sequence

MYRIGQLAKLAEVTPDTIRFYEKQGMMDHQTRTDGGYRLYTEQDLHRLRFIRYAKQLGFTLEAITELLSIRVDPEHHTCRESKQIVDDRLKDVETKLVEMQRMRDSLKMLSDACCGTAHVSSQCTILEILEQGATEPCGCSQKESKHNQ

Flanking regions ( +/- flanking 50bp)

TACTATTCTGATATGATGGCTTCAGGCCAGATGATGTCAGGAGGTTGCCGATGTACCGAATTGGTCAGTTAGCAAAACTTGCAGAAGTGACACCGGATACGATCCGTTTTTATGAAAAACAGGGCATGATGGATCATCAGACCCGGACGGATGGCGGCTATCGTTTGTATACTGAGCAGGATCTGCACCGGCTGCGTTTTATCCGGTATGCAAAACAATTAGGGTTTACACTGGAAGCGATCACGGAACTGTTATCGATCCGGGTTGATCCTGAACATCACACCTGCCGTGAATCAAAGCAAATTGTGGATGATCGGCTGAAAGATGTGGAAACGAAGTTAGTCGAAATGCAGCGAATGCGGGATTCTCTGAAGATGCTGAGTGATGCCTGTTGCGGAACGGCACATGTCAGTTCACAATGCACCATTCTGGAGATCCTGGAACAAGGTGCGACAGAGCCCTGTGGCTGTTCACAAAAAGAGAGTAAACATAATCAATGAGGTTACTATGACAAAATATGCTCACAAGCGTGGCGTAATACAAGATAACG