Homologs in group_3074

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18815 FBDBKF_18815 100.0 Morganella morganii S1 cobT nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase
EHELCC_17010 EHELCC_17010 100.0 Morganella morganii S2 cobT nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase
LHKJJB_09235 LHKJJB_09235 100.0 Morganella morganii S3 cobT nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase
HKOGLL_08785 HKOGLL_08785 100.0 Morganella morganii S5 cobT nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase
F4V73_RS13780 F4V73_RS13780 92.9 Morganella psychrotolerans cobT nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase

Distribution of the homologs in the orthogroup group_3074

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3074

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B5EWY2 2.55e-139 402 58 1 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Salmonella agona (strain SL483)
C0Q1R0 1.14e-138 400 58 1 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Salmonella paratyphi C (strain RKS4594)
B7L916 1.39e-138 400 56 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli (strain 55989 / EAEC)
B5BG60 2.29e-138 400 58 1 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Salmonella paratyphi A (strain AKU_12601)
A9MLS8 2.54e-138 400 58 1 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q05603 3e-138 399 58 1 349 1 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9MTA4 3e-138 399 58 1 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SWC5 3e-138 399 58 1 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Salmonella newport (strain SL254)
B4T8W8 3e-138 399 58 1 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Salmonella heidelberg (strain SL476)
B5QYX3 3e-138 399 58 1 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Salmonella enteritidis PT4 (strain P125109)
B5FLY4 3e-138 399 58 1 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Salmonella dublin (strain CT_02021853)
Q8Z5N9 3.58e-138 399 58 1 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Salmonella typhi
B4TZP5 4.08e-138 399 58 1 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Salmonella schwarzengrund (strain CVM19633)
B5RBK6 1.26e-137 398 58 1 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q5PDU9 1.3e-137 398 58 1 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
A8A1K5 1.75e-137 398 56 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli O9:H4 (strain HS)
Q1RAB7 1.95e-137 397 55 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli (strain UTI89 / UPEC)
Q8FGA5 1.95e-137 397 55 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TGE1 1.95e-137 397 55 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7NR83 1.95e-137 397 55 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B1LPV7 2.33e-137 397 56 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli (strain SMS-3-5 / SECEC)
B7UT20 2.54e-137 397 56 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A1ACI8 3.84e-137 397 56 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli O1:K1 / APEC
B5YSS0 3.84e-137 397 56 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X8V0 3.84e-137 397 56 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli O157:H7
B7MDB7 3.84e-137 397 56 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
B7NC25 3.93e-137 397 56 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
Q83R14 4.1e-137 397 55 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shigella flexneri
B1IZQ9 4.68e-137 397 56 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A7ZNF5 8.44e-137 396 55 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
A1JTP8 2.33e-136 395 58 0 348 1 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
P36562 3.45e-136 394 55 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli (strain K12)
B1X6S9 3.45e-136 394 55 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli (strain K12 / DH10B)
C4ZQQ4 3.45e-136 394 55 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli (strain K12 / MC4100 / BW2952)
B7MWP8 3.45e-136 394 55 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli O81 (strain ED1a)
Q3Z0K4 1.64e-135 393 55 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shigella sonnei (strain Ss046)
Q32ED0 1.89e-135 392 55 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
B6I828 2.46e-135 392 55 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli (strain SE11)
B7M3C7 2.46e-135 392 55 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli O8 (strain IAI1)
B2TWR0 1.19e-134 390 56 3 356 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q7N2U4 1.99e-134 389 57 2 350 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q0T3C4 4.25e-133 387 54 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shigella flexneri serotype 5b (strain 8401)
A6TKH4 1.41e-108 324 48 1 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Alkaliphilus metalliredigens (strain QYMF)
Q180T6 2.01e-95 290 44 1 338 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Clostridioides difficile (strain 630)
Q97JB4 2.64e-89 275 42 1 336 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8XLK7 6.1e-85 264 41 3 336 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Clostridium perfringens (strain 13 / Type A)
Q0TRK5 2.44e-83 260 41 3 336 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
A4J829 3.45e-83 259 41 3 350 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
B8I7A3 7.75e-83 258 42 1 336 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
B1I4H2 1.26e-81 255 45 1 329 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Desulforudis audaxviator (strain MP104C)
Q3ARQ5 5.59e-81 253 42 1 343 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Chlorobium chlorochromatii (strain CaD3)
A3DF00 7.54e-81 253 41 2 339 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q891S7 1.49e-78 248 39 1 338 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Clostridium tetani (strain Massachusetts / E88)
Q748J3 1.11e-77 245 42 3 343 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
C6E7Q4 3.22e-77 244 39 1 348 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Geobacter sp. (strain M21)
B9LZU2 1.55e-76 242 40 3 352 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
A5G962 1.81e-76 242 40 1 339 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Geotalea uraniireducens (strain Rf4)
B5EEL9 2.1e-76 242 39 1 339 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
B3QNS6 1.45e-75 239 38 1 346 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q8KDU8 1.66e-74 237 37 1 346 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
A1BF69 2.72e-74 236 39 1 346 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
A4SEC8 3.77e-74 236 41 1 337 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q39YG4 4.84e-74 236 43 1 346 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q9KG31 2.81e-72 231 40 2 345 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
B4SH92 1e-71 230 42 1 337 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
A5UQS8 1.8e-71 229 41 1 339 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Roseiflexus sp. (strain RS-1)
A1V9L9 2.32e-71 229 39 3 350 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Nitratidesulfovibrio vulgaris (strain DP4)
Q725Z4 4.2e-71 228 39 3 350 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A0LF21 6.92e-69 223 39 3 347 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
A7NH25 1.15e-68 222 40 1 339 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Roseiflexus castenholzii (strain DSM 13941 / HLO8)
A5FRG9 1.15e-68 222 39 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
Q30US7 1.68e-68 221 39 3 348 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q3ZX54 1.77e-68 221 38 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Dehalococcoides mccartyi (strain CBDB1)
C4XMZ1 8.73e-68 219 39 2 348 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q6ALU4 8.78e-65 212 40 3 343 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
B4S893 9.55e-65 212 34 1 339 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
B9LKQ0 2.16e-63 208 40 1 348 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WIQ7 2.16e-63 208 40 1 348 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q3A798 1.79e-62 206 41 2 342 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
B8CJ37 8.38e-60 199 37 4 331 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella piezotolerans (strain WP3 / JCM 13877)
B8G806 9.12e-60 199 40 1 348 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Chloroflexus aggregans (strain MD-66 / DSM 9485)
A1S3L3 1.6e-59 198 36 2 338 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q3BQB7 2.58e-56 190 36 3 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q2P631 2.99e-56 189 36 3 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
B2SJ67 4.89e-56 189 36 3 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q8PHR3 6.05e-56 189 35 3 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Xanthomonas axonopodis pv. citri (strain 306)
B0RPU9 1.06e-54 186 36 2 320 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Xanthomonas campestris pv. campestris (strain B100)
Q8P6B1 3.52e-54 184 36 2 320 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UXQ4 3.52e-54 184 36 2 320 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Xanthomonas campestris pv. campestris (strain 8004)
B7VPD7 5.47e-54 184 36 9 351 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Vibrio atlanticus (strain LGP32)
Q7SIC7 8.09e-54 183 37 3 326 1 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q9RYR8 1.97e-53 183 37 3 344 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A6L518 3.18e-53 182 34 5 339 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
A8FZR5 5.18e-53 181 32 1 339 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella sediminis (strain HAW-EB3)
Q8RF14 5.82e-53 181 33 2 333 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
C1DPN9 1.08e-52 181 36 2 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q7MWC6 1.28e-52 180 36 4 330 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q88M95 1.46e-52 180 36 2 330 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
A0L0D3 1.6e-52 180 35 2 337 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella sp. (strain ANA-3)
A4XAM8 5.51e-52 179 36 2 348 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
Q4K8C1 5.9e-52 179 37 1 311 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
B2RIR0 6.67e-52 178 36 4 330 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q4ZQ66 8.43e-52 178 37 3 327 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudomonas syringae pv. syringae (strain B728a)
Q02JC0 1.6e-51 177 35 3 339 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudomonas aeruginosa (strain UCBPP-PA14)
Q9I465 1.72e-51 177 35 3 339 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B1J1N8 2.13e-51 177 36 3 339 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudomonas putida (strain W619)
B0TT63 3.93e-51 176 34 2 328 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella halifaxensis (strain HAW-EB4)
A3QAT8 7.76e-51 175 35 1 317 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A5W7Q4 1.08e-50 175 36 2 330 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B7UWH1 1.12e-50 175 35 3 339 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudomonas aeruginosa (strain LESB58)
Q48FJ9 4.29e-50 174 36 3 327 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A9B732 6.09e-50 173 36 2 338 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
Q0HLZ5 8.37e-50 173 35 1 340 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella sp. (strain MR-4)
Q0HRU1 1.95e-49 172 35 1 336 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella sp. (strain MR-7)
A6WJZ1 4.28e-49 171 34 3 346 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella baltica (strain OS185)
Q086T6 5.72e-49 171 34 5 325 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella frigidimarina (strain NCIMB 400)
A9L3D8 9.38e-49 171 34 3 346 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella baltica (strain OS195)
A1RGP1 1.15e-48 170 35 1 336 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella sp. (strain W3-18-1)
A3D7X8 1.45e-48 170 35 3 334 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella baltica (strain OS155 / ATCC BAA-1091)
Q8EI18 1.51e-48 169 35 1 336 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B8E4M8 1.79e-48 170 35 3 334 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella baltica (strain OS223)
Q3IK32 2.12e-48 169 33 2 345 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudoalteromonas translucida (strain TAC 125)
A4Y9P3 1.84e-47 167 36 1 327 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q5LCE6 5.85e-47 165 33 5 339 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q64TE4 7.62e-47 165 33 5 339 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Bacteroides fragilis (strain YCH46)
Q885W6 1.52e-46 164 35 3 327 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
C3K0Y8 4.03e-46 163 37 1 326 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudomonas fluorescens (strain SBW25)
Q1IDJ7 9.89e-46 162 35 2 331 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudomonas entomophila (strain L48)
Q0K7H7 2.22e-45 161 35 3 339 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q6LSY3 7.4e-45 160 30 2 337 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Photobacterium profundum (strain SS9)
B0KT67 9.55e-45 160 35 2 330 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudomonas putida (strain GB-1)
Q89Q54 1.41e-44 159 34 4 317 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
A6LIW6 1.58e-44 159 33 5 331 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
A4XT55 8.54e-44 157 36 1 337 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudomonas mendocina (strain ymp)
Q47JS4 1.25e-43 157 34 2 327 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Dechloromonas aromatica (strain RCB)
B3R647 1.69e-43 156 34 3 339 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
A6SWY0 1.9e-43 156 33 4 318 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Janthinobacterium sp. (strain Marseille)
Q3KFR5 2.47e-43 156 37 1 326 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudomonas fluorescens (strain Pf0-1)
Q9KSL9 3.61e-43 155 32 4 342 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
B2HGX6 1.34e-42 154 34 4 321 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Mycobacterium marinum (strain ATCC BAA-535 / M)
Q7P0S3 2.13e-42 153 33 2 338 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q5P2R4 2.34e-42 153 32 3 322 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A0PTP2 9.64e-42 152 33 4 321 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Mycobacterium ulcerans (strain Agy99)
Q72M35 4.61e-41 150 29 1 322 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q8EYK9 5.28e-41 150 29 1 322 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q1GJ55 1.01e-40 149 34 5 341 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Ruegeria sp. (strain TM1040)
Q7MLF3 1.12e-40 149 34 6 339 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Vibrio vulnificus (strain YJ016)
Q8D921 1.19e-40 149 34 6 339 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Vibrio vulnificus (strain CMCP6)
Q9X7F4 5.17e-40 147 33 4 342 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Methylorubrum extorquens (strain CM4 / NCIMB 13688)
D5AV20 6.51e-40 146 34 5 316 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
A5EGF4 7.08e-40 147 35 2 320 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
P9WP85 7.91e-40 147 35 2 313 1 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WP84 7.91e-40 147 35 2 313 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U4N5 7.91e-40 147 35 2 313 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AQC2 7.91e-40 147 35 2 313 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KKP9 7.91e-40 147 35 2 313 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P63842 7.91e-40 147 35 2 313 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q73YK7 1.81e-39 145 35 4 343 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q169A0 2.23e-39 145 32 3 344 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q055Y6 9.49e-39 144 28 1 322 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04PD9 9.49e-39 144 28 1 322 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
C5CKN8 9.83e-39 144 31 5 361 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Variovorax paradoxus (strain S110)
A1KBH0 2.13e-38 143 32 4 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Azoarcus sp. (strain BH72)
Q8NNJ8 3.9e-38 142 32 2 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
A0QEZ9 4.9e-38 142 36 4 327 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Mycobacterium avium (strain 104)
Q8XWS3 9.85e-38 141 32 3 331 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A4QFR5 1.08e-37 141 32 2 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Corynebacterium glutamicum (strain R)
Q2GBJ7 1.77e-37 140 32 3 344 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
A4YXK4 4.19e-37 139 34 2 311 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Bradyrhizobium sp. (strain ORS 278)
A7MVW6 5.15e-37 139 31 4 350 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Vibrio campbellii (strain ATCC BAA-1116)
O32953 7.89e-37 139 34 6 348 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Mycobacterium leprae (strain TN)
B8ZQK8 7.89e-37 139 34 6 348 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Mycobacterium leprae (strain Br4923)
Q28M40 6.31e-36 136 35 9 334 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Jannaschia sp. (strain CCS1)
Q8FNQ2 6.6e-36 137 33 2 331 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
A6X1H0 1.56e-35 135 33 4 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q5LTJ1 2.46e-35 134 34 4 310 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q98KN9 1.57e-34 132 34 5 353 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q82AM7 2.15e-34 133 32 5 295 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
B8ERB9 2.48e-34 132 31 2 338 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q9S2R1 7.29e-34 131 31 4 312 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q87Q46 1.13e-33 130 31 4 341 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q57DN9 1.34e-33 130 33 4 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Brucella abortus biovar 1 (strain 9-941)
Q2YNK7 1.34e-33 130 33 4 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Brucella abortus (strain 2308)
B2S5A1 1.34e-33 130 33 4 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Brucella abortus (strain S19)
Q92P98 1.61e-33 129 32 5 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Rhizobium meliloti (strain 1021)
A6U9W4 2.05e-33 129 32 5 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Sinorhizobium medicae (strain WSM419)
Q8G155 2.11e-32 127 33 4 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Brucella suis biovar 1 (strain 1330)
B0CLJ2 2.11e-32 127 33 4 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Brucella suis (strain ATCC 23445 / NCTC 10510)
A9MAP0 2.11e-32 127 33 4 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
A3PIN5 2.49e-32 126 30 3 346 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
P29935 3.06e-32 126 31 5 335 1 cobU Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Sinorhizobium sp.
B9JW09 9.07e-32 125 31 4 319 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
C3MDH9 1.95e-31 124 31 4 319 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
C0RIK0 2.65e-31 124 33 5 343 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Brucella melitensis biotype 2 (strain ATCC 23457)
B9JG15 9.56e-31 122 32 5 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
B9KQ95 2.13e-30 121 29 3 346 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
A4WRE3 2.78e-30 121 30 3 344 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q8YGQ9 4e-30 120 32 5 343 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
B3PQS3 4.77e-30 120 31 5 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Rhizobium etli (strain CIAT 652)
Q3J3P6 6.62e-30 120 29 3 346 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q1MFK4 1.49e-29 119 31 5 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B5ZSC4 4.17e-29 118 31 4 343 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q8UE71 1.45e-27 114 30 5 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q2K7G6 6.7e-27 112 31 5 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
P0CY58 8.04e-09 56 34 0 83 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (Fragment) Rhodobacter capsulatus

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_18390
Feature type CDS
Gene cobT
Product nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase
Location 10045 - 11106 (strand: -1)
Length 1062 (nucleotides) / 353 (amino acids)
In genomic island -

Contig

Accession ZDB_541
Length 32595 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3074
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF02277 Phosphoribosyltransferase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2038 Coenzyme transport and metabolism (H) H NaMN:DMB phosphoribosyltransferase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00768 nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase [EC:2.4.2.21] Porphyrin metabolism
Metabolic pathways
Biosynthesis of cofactors
Cobalamin biosynthesis, cobyrinate a,c-diamide => cobalamin

Protein Sequence

MTKLKDLIRAIPPLDHAAMQAAEQHINGLAKPPRSLGRLEDLAVHLAGMPGIDHPDNLPKEIIVMCADHGVFAEGVAVTPQEVTAIQARNIQKQLTGVCAVARSNGTSVLPVDIGIDCDPIDDMISLKLARGCGNIAKGPAMSYADAEHLLVASAELVKQRVAAGIRVVGTGELGIANTTPASAMISVLCGLDPHDTVGIGANLPLDRVSHKEAIVRQAIALNKPDPADAIDVLAKVGGYDLTGMTGVILGAAACGIPVVLDGFLSYACAIAACRLAPAVRDYLIPSHFSAEKGAGIALEQLGLKPFLYLDLRLGEGSGAALAMSVINAACSMYCHMGHQAGSGFTLPPSPTR

Flanking regions ( +/- flanking 50bp)

GTTTTACGCCTGTTGTTTGATTATAAAAATATAATGTGAGCATAAAAACAATGACAAAACTGAAAGACCTGATCCGCGCGATCCCGCCTCTGGATCACGCGGCCATGCAGGCGGCAGAGCAGCATATCAACGGATTAGCCAAGCCGCCGCGCAGTCTCGGCCGCCTGGAAGATCTGGCGGTACATCTTGCCGGAATGCCGGGGATTGACCATCCGGATAATCTGCCGAAAGAAATTATTGTGATGTGTGCGGACCACGGCGTATTTGCAGAAGGTGTCGCCGTCACCCCGCAGGAAGTCACTGCTATCCAGGCCCGCAATATTCAGAAACAGCTGACCGGTGTCTGCGCGGTTGCCCGCAGCAACGGCACCAGTGTGCTGCCGGTGGATATCGGCATTGACTGCGATCCTATCGATGACATGATTTCCCTGAAACTGGCACGCGGCTGCGGCAATATAGCCAAAGGCCCGGCAATGTCTTATGCCGATGCAGAACATCTGCTGGTTGCCAGTGCAGAGCTGGTAAAACAGCGGGTTGCCGCCGGGATCCGCGTTGTCGGCACCGGAGAACTGGGGATCGCCAATACCACCCCGGCGTCTGCGATGATCAGCGTCCTGTGCGGGCTTGATCCGCATGATACCGTCGGTATCGGCGCCAATCTGCCGCTGGATCGCGTCTCGCACAAAGAAGCGATCGTCAGACAGGCTATCGCGCTGAACAAGCCGGATCCTGCGGATGCCATTGATGTGCTCGCCAAAGTCGGCGGGTATGATCTGACCGGGATGACCGGTGTGATTCTGGGTGCCGCAGCCTGCGGCATTCCTGTCGTGCTCGACGGCTTTTTATCTTACGCCTGCGCCATCGCGGCCTGCCGTCTGGCCCCTGCTGTCCGGGACTATCTTATCCCGTCCCACTTTTCCGCCGAGAAAGGCGCGGGTATCGCGCTTGAGCAGCTCGGTCTGAAACCTTTTTTATATTTGGATCTCCGGCTGGGTGAAGGCAGCGGCGCGGCATTAGCCATGTCCGTCATTAATGCCGCATGCAGCATGTATTGTCATATGGGGCATCAGGCCGGGAGTGGTTTCACTCTGCCGCCATCCCCCACCCGGTAAAATGGATTATATTTTTAGGGAGTAAAACGCCATGCGAAAGAAGATCCCGA