Homologs in group_3074

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_18815 FBDBKF_18815 92.9 Morganella morganii S1 cobT nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase
EHELCC_17010 EHELCC_17010 92.9 Morganella morganii S2 cobT nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase
NLDBIP_18390 NLDBIP_18390 92.9 Morganella morganii S4 cobT nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase
LHKJJB_09235 LHKJJB_09235 92.9 Morganella morganii S3 cobT nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase
HKOGLL_08785 HKOGLL_08785 92.9 Morganella morganii S5 cobT nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase

Distribution of the homologs in the orthogroup group_3074

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_3074

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B7L916 1.26e-142 410 57 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli (strain 55989 / EAEC)
B5EWY2 2.98e-142 410 58 1 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Salmonella agona (strain SL483)
C0Q1R0 1.5e-141 408 58 1 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Salmonella paratyphi C (strain RKS4594)
A1ACI8 1.76e-141 408 57 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli O1:K1 / APEC
B5YSS0 1.76e-141 408 57 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli O157:H7 (strain EC4115 / EHEC)
Q8X8V0 1.76e-141 408 57 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli O157:H7
B7MDB7 1.76e-141 408 57 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli O45:K1 (strain S88 / ExPEC)
B1LPV7 2.05e-141 408 57 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli (strain SMS-3-5 / SECEC)
B5BG60 2.32e-141 407 58 1 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Salmonella paratyphi A (strain AKU_12601)
Q05603 2.37e-141 407 58 1 349 1 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
A9MTA4 2.37e-141 407 58 1 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
B4SWC5 2.37e-141 407 58 1 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Salmonella newport (strain SL254)
B4T8W8 2.37e-141 407 58 1 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Salmonella heidelberg (strain SL476)
B5QYX3 2.37e-141 407 58 1 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Salmonella enteritidis PT4 (strain P125109)
B5FLY4 2.37e-141 407 58 1 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Salmonella dublin (strain CT_02021853)
B7NC25 2.84e-141 407 57 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
A9MLS8 3.25e-141 407 58 1 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q8Z5N9 3.6e-141 407 58 1 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Salmonella typhi
Q1RAB7 4.86e-141 407 56 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli (strain UTI89 / UPEC)
Q8FGA5 4.86e-141 407 56 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TGE1 4.86e-141 407 56 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
B7NR83 4.86e-141 407 56 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B1IZQ9 4.91e-141 407 57 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
A8A1K5 4.96e-141 407 57 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli O9:H4 (strain HS)
B7UT20 5.91e-141 406 57 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B4TZP5 6.49e-141 406 58 1 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Salmonella schwarzengrund (strain CVM19633)
A7ZNF5 8.11e-141 406 57 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli O139:H28 (strain E24377A / ETEC)
Q83R14 9.15e-141 406 56 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shigella flexneri
B5RBK6 1.07e-140 405 58 1 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Salmonella gallinarum (strain 287/91 / NCTC 13346)
Q5PDU9 1.5e-140 405 58 1 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q3Z0K4 1.6e-139 403 56 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shigella sonnei (strain Ss046)
Q32ED0 1.75e-139 403 56 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shigella dysenteriae serotype 1 (strain Sd197)
B6I828 2.27e-139 402 56 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli (strain SE11)
B7M3C7 2.27e-139 402 56 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli O8 (strain IAI1)
P36562 4.72e-139 402 55 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli (strain K12)
B1X6S9 4.72e-139 402 55 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli (strain K12 / DH10B)
C4ZQQ4 4.72e-139 402 55 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli (strain K12 / MC4100 / BW2952)
B7MWP8 4.72e-139 402 55 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Escherichia coli O81 (strain ED1a)
A1JTP8 1.19e-138 400 58 0 348 1 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
B2TWR0 1.98e-138 400 57 3 356 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
Q0T3C4 1.26e-136 395 55 2 354 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shigella flexneri serotype 5b (strain 8401)
Q7N2U4 6.4e-136 393 56 0 348 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A6TKH4 4.61e-105 315 46 1 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Alkaliphilus metalliredigens (strain QYMF)
Q180T6 1.56e-100 303 46 1 338 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Clostridioides difficile (strain 630)
Q97JB4 2.99e-86 267 41 1 337 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8XLK7 7.82e-85 264 40 3 337 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Clostridium perfringens (strain 13 / Type A)
Q0TRK5 2.1e-83 260 40 3 337 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
B8I7A3 2.99e-83 259 42 3 341 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
A4J829 2.58e-81 254 40 3 350 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
A3DF00 1.62e-80 252 41 4 343 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
B1I4H2 3.84e-80 251 44 1 329 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Desulforudis audaxviator (strain MP104C)
Q891S7 9.8e-79 248 39 1 338 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Clostridium tetani (strain Massachusetts / E88)
C6E7Q4 4.12e-77 243 39 1 348 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Geobacter sp. (strain M21)
B9LZU2 1.95e-76 242 40 3 352 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
B5EEL9 2.39e-76 241 39 1 339 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q748J3 4.74e-76 241 41 1 339 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A5G962 1.34e-75 239 40 1 339 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Geotalea uraniireducens (strain Rf4)
B3QNS6 2.82e-72 231 37 1 345 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q39YG4 3.07e-72 231 42 1 346 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q3ARQ5 3.97e-72 231 40 1 336 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Chlorobium chlorochromatii (strain CaD3)
A4SEC8 1.35e-71 229 41 3 337 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
A1BF69 3.65e-71 228 39 1 345 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Chlorobium phaeobacteroides (strain DSM 266 / SMG 266 / 2430)
Q8KDU8 2.65e-70 226 36 1 345 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
B4SH92 4.89e-69 223 40 3 347 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q9KG31 1.37e-68 222 38 1 347 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A1V9L9 6.18e-68 220 38 3 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Nitratidesulfovibrio vulgaris (strain DP4)
Q725Z4 1.13e-67 219 38 3 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
C4XMZ1 5.24e-66 215 38 2 348 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
A5FRG9 6.41e-66 215 37 2 353 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
Q30US7 6.73e-66 215 38 5 357 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A0LF21 8.26e-66 214 38 4 341 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
A5UQS8 8.35e-66 214 38 1 348 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Roseiflexus sp. (strain RS-1)
Q3ZX54 1.16e-65 214 37 2 353 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Dehalococcoides mccartyi (strain CBDB1)
A7NH25 7.1e-64 209 38 1 348 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Roseiflexus castenholzii (strain DSM 13941 / HLO8)
B4S893 1.7e-62 206 33 1 345 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Prosthecochloris aestuarii (strain DSM 271 / SK 413)
Q6ALU4 7.37e-60 199 39 5 348 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q3A798 1.11e-59 199 41 2 281 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
B9LKQ0 2.03e-59 198 39 1 348 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WIQ7 2.03e-59 198 39 1 348 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
B8CJ37 7.21e-59 196 37 2 330 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella piezotolerans (strain WP3 / JCM 13877)
A1S3L3 1.21e-56 191 37 2 318 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B8G806 1.65e-56 191 40 1 348 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Chloroflexus aggregans (strain MD-66 / DSM 9485)
Q7SIC7 2.5e-53 182 37 3 320 1 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
A8FZR5 3.68e-53 181 33 3 343 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella sediminis (strain HAW-EB3)
Q88M95 1.65e-52 180 37 4 332 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q8RF14 2.42e-52 179 33 4 334 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q3BQB7 3.59e-51 176 34 3 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
B7VPD7 4.28e-51 176 34 5 344 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Vibrio atlanticus (strain LGP32)
Q8PHR3 1.18e-50 175 34 3 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Xanthomonas axonopodis pv. citri (strain 306)
A5W7Q4 1.98e-50 174 36 4 332 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
B0TT63 2.99e-50 174 34 1 327 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella halifaxensis (strain HAW-EB4)
C1DPN9 3.68e-50 174 36 2 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A0L0D3 4.62e-50 174 34 1 338 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella sp. (strain ANA-3)
Q2P631 7.16e-50 173 34 3 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
B2SJ67 1.06e-49 172 34 3 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q4K8C1 1.6e-49 172 36 3 316 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A6L518 1.9e-49 172 33 3 325 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
Q02JC0 5.31e-49 171 36 1 324 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudomonas aeruginosa (strain UCBPP-PA14)
Q9I465 5.78e-49 171 35 1 324 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q4ZQ66 5.82e-49 171 36 5 329 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudomonas syringae pv. syringae (strain B728a)
A4XAM8 9.19e-49 171 35 5 363 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
Q7MWC6 1.15e-48 170 35 5 330 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
B0RPU9 1.21e-48 170 35 2 320 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Xanthomonas campestris pv. campestris (strain B100)
B1J1N8 1.32e-48 170 37 4 332 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudomonas putida (strain W619)
B2RIR0 1.82e-48 169 35 5 330 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q8P6B1 1.89e-48 169 35 2 320 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UXQ4 1.89e-48 169 35 2 320 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Xanthomonas campestris pv. campestris (strain 8004)
Q0HLZ5 2.14e-48 169 35 1 333 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella sp. (strain MR-4)
Q8EI18 2.85e-48 169 35 1 329 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B7UWH1 3.54e-48 169 35 1 324 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudomonas aeruginosa (strain LESB58)
Q0HRU1 4.5e-48 168 35 1 329 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella sp. (strain MR-7)
Q9RYR8 5.44e-48 169 35 3 344 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
A3QAT8 5.77e-48 168 34 1 327 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A9B732 6.11e-48 168 36 2 338 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
A6WJZ1 9.51e-48 168 34 3 339 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella baltica (strain OS185)
A9L3D8 2.74e-47 167 34 3 339 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella baltica (strain OS195)
Q48FJ9 2.93e-47 166 35 3 327 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
A3D7X8 3.24e-47 166 34 3 334 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E4M8 3.52e-47 166 34 3 327 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella baltica (strain OS223)
Q086T6 3.7e-47 166 34 5 325 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella frigidimarina (strain NCIMB 400)
A1RGP1 5.7e-46 163 35 1 329 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella sp. (strain W3-18-1)
B0KT67 2.9e-45 161 35 4 332 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudomonas putida (strain GB-1)
Q1IDJ7 1.18e-44 159 34 1 330 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudomonas entomophila (strain L48)
Q5LCE6 1.47e-44 159 32 3 334 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
Q64TE4 1.65e-44 159 32 3 325 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Bacteroides fragilis (strain YCH46)
Q3IK32 1.8e-44 159 31 6 364 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudoalteromonas translucida (strain TAC 125)
Q6LSY3 4.45e-44 157 29 2 327 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Photobacterium profundum (strain SS9)
A4Y9P3 4.77e-44 158 35 1 320 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q0K7H7 5.6e-44 157 35 3 339 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q885W6 2.39e-43 156 34 3 327 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
B3R647 2.07e-42 153 34 3 339 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
C3K0Y8 3.38e-42 153 36 4 328 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudomonas fluorescens (strain SBW25)
B2HGX6 5.36e-42 152 34 4 321 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Mycobacterium marinum (strain ATCC BAA-535 / M)
Q47JS4 6.94e-42 152 34 4 325 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Dechloromonas aromatica (strain RCB)
Q5P2R4 7.82e-42 152 32 5 326 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A0PTP2 4.89e-41 150 34 4 321 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Mycobacterium ulcerans (strain Agy99)
A6LIW6 7.81e-41 149 32 5 328 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q7P0S3 9.81e-41 149 33 2 347 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A4XT55 1.43e-40 149 37 6 333 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudomonas mendocina (strain ymp)
A6SWY0 2.95e-40 147 32 4 318 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Janthinobacterium sp. (strain Marseille)
Q89Q54 4.46e-40 147 32 3 315 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q8D921 6.18e-40 147 33 7 339 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Vibrio vulnificus (strain CMCP6)
Q7MLF3 1.12e-39 146 33 7 339 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Vibrio vulnificus (strain YJ016)
Q1GJ55 1.36e-39 145 33 5 349 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Ruegeria sp. (strain TM1040)
C5CKN8 4.59e-39 145 31 4 353 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Variovorax paradoxus (strain S110)
Q3KFR5 1.39e-38 143 37 3 313 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Pseudomonas fluorescens (strain Pf0-1)
Q9KSL9 2.58e-38 142 31 5 343 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q72M35 7.27e-38 141 28 1 315 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q8EYK9 8.95e-38 141 28 1 315 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
A1KBH0 1.16e-37 141 32 4 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Azoarcus sp. (strain BH72)
Q8XWS3 4.84e-37 139 33 3 326 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q2GBJ7 5.88e-37 139 32 3 344 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q9X7F4 1.69e-36 137 31 4 342 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Methylorubrum extorquens (strain CM4 / NCIMB 13688)
A5EGF4 5.62e-36 136 33 2 329 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
P9WP85 7.08e-36 136 33 2 320 1 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WP84 7.08e-36 136 33 2 320 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U4N5 7.08e-36 136 33 2 320 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AQC2 7.08e-36 136 33 2 320 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KKP9 7.08e-36 136 33 2 320 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P63842 7.08e-36 136 33 2 320 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A7MVW6 1.24e-35 135 30 6 353 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Vibrio campbellii (strain ATCC BAA-1116)
Q169A0 2.31e-35 134 31 4 346 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q8NNJ8 4.17e-35 134 31 3 340 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q73YK7 8.23e-35 133 34 4 343 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A4QFR5 1.18e-34 133 30 3 340 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Corynebacterium glutamicum (strain R)
Q055Y6 1.67e-34 132 28 1 315 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04PD9 1.67e-34 132 28 1 315 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
O32953 2.7e-34 132 33 5 331 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Mycobacterium leprae (strain TN)
B8ZQK8 2.7e-34 132 33 5 331 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Mycobacterium leprae (strain Br4923)
A0QEZ9 5.57e-34 131 35 4 325 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Mycobacterium avium (strain 104)
Q82AM7 9.56e-34 131 30 4 294 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
D5AV20 2.23e-33 129 31 6 314 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q9S2R1 2.46e-33 129 30 4 312 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q28M40 4.09e-33 129 33 6 325 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Jannaschia sp. (strain CCS1)
A6U9W4 5.19e-33 128 32 6 343 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Sinorhizobium medicae (strain WSM419)
Q5LTJ1 5.94e-33 128 33 6 324 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
A4YXK4 6.74e-33 128 32 2 320 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Bradyrhizobium sp. (strain ORS 278)
Q92P98 9.24e-33 127 32 6 346 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Rhizobium meliloti (strain 1021)
A6X1H0 1.15e-32 127 32 4 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q8FNQ2 2.52e-32 127 32 3 332 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
P29935 3.68e-32 126 31 4 343 1 cobU Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Sinorhizobium sp.
B8ERB9 7e-32 125 31 2 338 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q98KN9 1.08e-31 125 33 7 345 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q87Q46 1.16e-31 125 31 6 344 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B9JG15 1.41e-30 122 32 5 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
B9JW09 1.45e-30 122 32 4 316 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q57DN9 2.69e-30 121 32 4 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Brucella abortus biovar 1 (strain 9-941)
Q2YNK7 2.69e-30 121 32 4 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Brucella abortus (strain 2308)
B2S5A1 2.69e-30 121 32 4 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Brucella abortus (strain S19)
C3MDH9 4.68e-30 120 32 5 343 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B3PQS3 1.71e-29 119 31 4 343 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Rhizobium etli (strain CIAT 652)
Q8G155 4.15e-29 118 32 4 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Brucella suis biovar 1 (strain 1330)
B0CLJ2 4.15e-29 118 32 4 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Brucella suis (strain ATCC 23445 / NCTC 10510)
A9MAP0 4.15e-29 118 32 4 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q1MFK4 4.57e-29 117 31 4 343 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
A3PIN5 5.32e-29 117 29 4 341 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A4WRE3 4.29e-28 115 30 4 338 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
C0RIK0 4.78e-28 115 32 4 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Brucella melitensis biotype 2 (strain ATCC 23457)
B5ZSC4 9.77e-28 114 30 4 343 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Rhizobium leguminosarum bv. trifolii (strain WSM2304)
B9KQ95 4e-27 112 29 4 341 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q8YGQ9 7.47e-27 112 31 4 335 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8UE71 1.59e-26 111 30 4 345 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q3J3P6 1.65e-26 110 28 4 341 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q2K7G6 1.23e-25 108 31 4 318 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
P0CY58 0.000415 43 29 0 81 3 cobT Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (Fragment) Rhodobacter capsulatus

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS13780
Feature type CDS
Gene cobT
Product nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase
Location 388829 - 389890 (strand: 1)
Length 1062 (nucleotides) / 353 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000003
Length 425895 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_3074
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF02277 Phosphoribosyltransferase

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG2038 Coenzyme transport and metabolism (H) H NaMN:DMB phosphoribosyltransferase

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K00768 nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase [EC:2.4.2.21] Porphyrin metabolism
Metabolic pathways
Biosynthesis of cofactors
Cobalamin biosynthesis, cobyrinate a,c-diamide => cobalamin

Protein Sequence

MTTLEDLIRAIPPLDHAAMQAAEQHIGGLAKPPRSLGRLEDLAVLLAGMPGIDNLDDLPKEIIVMCADHGVFEEGVAVTPQNVTAIQARNIQKQLTGVCAVARSSGTSVLPVDIGIDCEPIDGMISLKLARGCGNIAKGPAMSYQDAEHLLISSAELVRTRVAEGIRVIGTGELGIANTTPASAMISVLCGLDPHDTVGIGANLPLDRVSHKEAIVRQAIALNQPDPADAVDVLAKIGGYDLTGMTGVILGAAACGIPVVLDGFLSYACAIAACRLAPKVRDYLIPSHFSAEKGAGIALEQLGLKPFLYLDLRLGEGSGAALAMSVINAACSMYCHMGHQAASGFSLPPSPTR

Flanking regions ( +/- flanking 50bp)

TGCAGTTTGAATGAATAAGGGTATAAAAATAATAATGTGAGCAAAAAACAATGACGACACTGGAAGACCTGATCCGTGCAATACCGCCATTGGATCACGCGGCTATGCAGGCGGCAGAGCAACATATCGGAGGATTAGCCAAGCCTCCGCGCAGCCTGGGACGGCTTGAAGACCTTGCTGTTCTCCTCGCGGGTATGCCGGGTATCGATAACCTCGATGATTTACCAAAAGAAATTATTGTGATGTGTGCGGATCACGGCGTATTTGAAGAAGGCGTCGCCGTCACACCACAGAATGTTACCGCTATCCAGGCGCGTAATATCCAAAAGCAACTGACCGGTGTTTGTGCGGTTGCCCGCAGCAGCGGAACCAGCGTGCTGCCGGTGGATATCGGCATTGATTGTGAGCCTATCGACGGCATGATCAGCCTGAAACTGGCACGGGGCTGCGGCAATATCGCCAAAGGTCCGGCGATGTCTTATCAGGATGCCGAACATCTATTGATCTCCAGCGCAGAATTAGTCCGAACCCGCGTGGCGGAAGGTATCCGCGTGATCGGTACCGGTGAGCTGGGCATTGCCAATACCACCCCGGCTTCTGCCATGATCAGTGTGCTGTGCGGGCTTGATCCGCATGATACTGTCGGGATCGGCGCTAATCTGCCACTGGATCGCGTTTCTCACAAAGAGGCGATAGTGCGTCAGGCTATCGCGCTGAATCAGCCGGACCCGGCGGATGCAGTTGATGTGCTTGCCAAAATCGGCGGGTACGACCTGACCGGAATGACCGGGGTTATCCTCGGCGCCGCCGCCTGCGGTATCCCGGTTGTCCTTGATGGTTTTTTATCCTACGCTTGTGCGATAGCCGCTTGTCGCCTGGCACCAAAAGTCCGTGATTATCTGATCCCGTCCCATTTTTCTGCGGAAAAAGGCGCGGGTATCGCCTTAGAGCAACTCGGACTCAAACCGTTCTTATATTTAGATCTCCGCCTGGGTGAAGGCAGTGGCGCGGCATTAGCAATGTCAGTCATCAACGCCGCGTGCAGTATGTACTGCCATATGGGACATCAGGCCGCCAGTGGTTTCTCGCTGCCGCCGTCTCCGACCCGGTAAAATGGATATTTTTTTAGGGAGTAAAACGCAATGCGAAAGAAGATCCCAAA