Homologs in group_2280

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17520 FBDBKF_17520 100.0 Morganella morganii S1 rpsU 30S ribosomal protein S21
EHELCC_17415 EHELCC_17415 100.0 Morganella morganii S2 rpsU 30S ribosomal protein S21
LHKJJB_17700 LHKJJB_17700 100.0 Morganella morganii S3 rpsU 30S ribosomal protein S21
HKOGLL_17710 HKOGLL_17710 100.0 Morganella morganii S5 rpsU 30S ribosomal protein S21
F4V73_RS16700 F4V73_RS16700 100.0 Morganella psychrotolerans rpsU 30S ribosomal protein S21
PMI_RS11720 PMI_RS11720 98.6 Proteus mirabilis HI4320 rpsU 30S ribosomal protein S21

Distribution of the homologs in the orthogroup group_2280

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2280

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
B1JM17 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q665U4 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4THT0 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Yersinia pestis (strain Pestoides F)
Q1CME3 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R7E4 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Yersinia pestis bv. Antiqua (strain Angola)
P68686 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Yersinia pestis
B2K2I4 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C365 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FE70 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JQX1 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q2NWE7 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Sodalis glossinidius (strain morsitans)
Q3YXH8 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Shigella sonnei (strain Ss046)
P68685 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Shigella flexneri
Q0T0J8 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Shigella flexneri serotype 5b (strain 8401)
Q32BQ2 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Shigella dysenteriae serotype 1 (strain Sd197)
Q31WW9 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Shigella boydii serotype 4 (strain Sb227)
B2U1G8 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
A8GJV2 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Serratia proteamaculans (strain 568)
P68684 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P68683 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Salmonella typhi
B4TVU3 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Salmonella schwarzengrund (strain CVM19633)
B5BG21 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Salmonella paratyphi A (strain AKU_12601)
C0PYY2 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Salmonella paratyphi C (strain RKS4594)
A9N5Y8 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PKX8 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T679 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Salmonella newport (strain SL254)
B4TI60 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Salmonella heidelberg (strain SL476)
B5REG7 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QZ45 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Salmonella enteritidis PT4 (strain P125109)
B5FHU4 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Salmonella dublin (strain CT_02021853)
Q57JQ0 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Salmonella choleraesuis (strain SC-B67)
A9MPV4 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F6A5 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Salmonella agona (strain SL483)
B4EW58 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Proteus mirabilis (strain HI4320)
P68682 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
C6DKG8 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D9D4 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A6TE47 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XU21 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Klebsiella pneumoniae (strain 342)
B7LQD9 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B2VGJ7 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A4WEK0 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Enterobacter sp. (strain 638)
Q1R6R5 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Escherichia coli (strain UTI89 / UPEC)
B1LF57 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Escherichia coli (strain SMS-3-5 / SECEC)
B6I437 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Escherichia coli (strain SE11)
B7ND54 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P68679 6.69e-43 135 98 0 71 1 rpsU Small ribosomal subunit protein bS21 Escherichia coli (strain K12)
B1IRQ1 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P68680 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TD41 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A4M2 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Escherichia coli O9:H4 (strain HS)
B1XG70 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Escherichia coli (strain K12 / DH10B)
C4ZQY2 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Escherichia coli (strain K12 / MC4100 / BW2952)
B7LZL5 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Escherichia coli O8 (strain IAI1)
B7N0L5 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Escherichia coli O81 (strain ED1a)
B7NJS8 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YRA5 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P68681 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Escherichia coli O157:H7
B7LH01 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Escherichia coli (strain 55989 / EAEC)
B7MB01 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UIX3 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZRU7 6.69e-43 135 98 0 71 3 rpsU Small ribosomal subunit protein bS21 Escherichia coli O139:H28 (strain E24377A / ETEC)
A8APV6 6.69e-43 135 98 0 71 1 rpsU Small ribosomal subunit protein bS21 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
C5BHG0 8.91e-43 135 97 0 71 3 rpsU Small ribosomal subunit protein bS21 Edwardsiella ictaluri (strain 93-146)
A4SRB0 1.73e-41 132 91 0 71 3 rpsU Small ribosomal subunit protein bS21 Aeromonas salmonicida (strain A449)
A0KGI4 1.73e-41 132 91 0 71 3 rpsU Small ribosomal subunit protein bS21 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
C4LB60 5.91e-41 131 91 0 71 3 rpsU Small ribosomal subunit protein bS21 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
C4K491 8.4e-41 130 91 0 71 3 rpsU Small ribosomal subunit protein bS21 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
Q7MP00 7.47e-40 128 90 0 71 3 rpsU Small ribosomal subunit protein bS21 Vibrio vulnificus (strain YJ016)
P66534 7.47e-40 128 90 0 71 3 rpsU Small ribosomal subunit protein bS21 Vibrio vulnificus (strain CMCP6)
P66533 7.47e-40 128 90 0 71 3 rpsU Small ribosomal subunit protein bS21 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
C3LS10 7.47e-40 128 90 0 71 3 rpsU Small ribosomal subunit protein bS21 Vibrio cholerae serotype O1 (strain M66-2)
P66532 7.47e-40 128 90 0 71 3 rpsU Small ribosomal subunit protein bS21 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F9E6 7.47e-40 128 90 0 71 3 rpsU Small ribosomal subunit protein bS21 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A7MWP7 7.47e-40 128 90 0 71 3 rpsU Small ribosomal subunit protein bS21 Vibrio campbellii (strain ATCC BAA-1116)
B7VIH1 1.06e-39 127 88 0 71 3 rpsU Small ribosomal subunit protein bS21 Vibrio atlanticus (strain LGP32)
Q6LV11 1.38e-39 127 90 0 71 3 rpsU Small ribosomal subunit protein bS21 Photobacterium profundum (strain SS9)
B5FB83 1.63e-39 127 88 0 71 3 rpsU Small ribosomal subunit protein bS21 Aliivibrio fischeri (strain MJ11)
Q5E2K1 1.63e-39 127 88 0 71 3 rpsU Small ribosomal subunit protein bS21 Aliivibrio fischeri (strain ATCC 700601 / ES114)
A1SRR4 2.7e-39 127 87 0 71 3 rpsU Small ribosomal subunit protein bS21 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
B8D6W9 2.7e-39 127 88 0 71 3 rpsU Small ribosomal subunit protein bS21 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57165 2.7e-39 127 88 0 71 3 rpsU Small ribosomal subunit protein bS21 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8L5 2.7e-39 127 88 0 71 3 rpsU Small ribosomal subunit protein bS21 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
Q8KA57 3.59e-39 126 87 0 71 3 rpsU Small ribosomal subunit protein bS21 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q8D284 3.8e-39 126 83 0 71 3 rpsU Small ribosomal subunit protein bS21 Wigglesworthia glossinidia brevipalpis
Q1LSM1 7.42e-39 125 88 0 71 3 rpsU Small ribosomal subunit protein bS21 Baumannia cicadellinicola subsp. Homalodisca coagulata
Q493X9 3.13e-38 124 84 0 71 3 rpsU Small ribosomal subunit protein bS21 Blochmanniella pennsylvanica (strain BPEN)
Q5QVL5 3.38e-38 124 85 0 71 3 rpsU Small ribosomal subunit protein bS21 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q058D2 2.31e-37 122 80 0 71 3 rpsU Small ribosomal subunit protein bS21 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q89B08 3.5e-37 121 81 0 71 3 rpsU Small ribosomal subunit protein bS21 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q9RGX2 7.39e-37 120 87 0 71 3 rpsU Small ribosomal subunit protein bS21 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B0BR65 9.62e-37 120 85 0 71 3 rpsU Small ribosomal subunit protein bS21 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3H2A8 9.62e-37 120 85 0 71 3 rpsU Small ribosomal subunit protein bS21 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N2C1 9.62e-37 120 85 0 71 3 rpsU Small ribosomal subunit protein bS21 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q9CLJ0 1.59e-36 119 83 0 71 3 rpsU Small ribosomal subunit protein bS21 Pasteurella multocida (strain Pm70)
Q65RP1 1.59e-36 119 83 0 71 3 rpsU Small ribosomal subunit protein bS21 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B0USS4 1.59e-36 119 83 0 71 3 rpsU Small ribosomal subunit protein bS21 Histophilus somni (strain 2336)
Q0I4Z6 1.59e-36 119 83 0 71 3 rpsU Small ribosomal subunit protein bS21 Histophilus somni (strain 129Pt)
Q3IIB6 1.7e-36 119 83 0 71 3 rpsU Small ribosomal subunit protein bS21 Pseudoalteromonas translucida (strain TAC 125)
A6VM96 2.64e-36 119 83 0 71 3 rpsU Small ribosomal subunit protein bS21 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P44386 5.22e-36 118 83 0 71 3 rpsU Small ribosomal subunit protein bS21 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UH36 5.22e-36 118 83 0 71 3 rpsU Small ribosomal subunit protein bS21 Haemophilus influenzae (strain PittGG)
A5U9W4 5.22e-36 118 83 0 71 3 rpsU Small ribosomal subunit protein bS21 Haemophilus influenzae (strain PittEE)
Q4QN17 5.22e-36 118 83 0 71 3 rpsU Small ribosomal subunit protein bS21 Haemophilus influenzae (strain 86-028NP)
B8F647 9.87e-36 117 84 0 71 3 rpsU Small ribosomal subunit protein bS21 Glaesserella parasuis serovar 5 (strain SH0165)
Q7VQR0 1.11e-35 117 78 0 71 3 rpsU Small ribosomal subunit protein bS21 Blochmanniella floridana
Q21MU8 1.33e-34 115 80 0 71 3 rpsU Small ribosomal subunit protein bS21 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
C5BPR2 6.76e-34 113 78 0 71 3 rpsU Small ribosomal subunit protein bS21 Teredinibacter turnerae (strain ATCC 39867 / T7901)
A1WW12 9e-34 112 76 0 71 3 rpsU Small ribosomal subunit protein bS21 Halorhodospira halophila (strain DSM 244 / SL1)
Q0A5M8 1.35e-33 112 77 0 71 3 rpsU Small ribosomal subunit protein bS21 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q4ZMF3 3.4e-33 111 78 0 71 3 rpsU Small ribosomal subunit protein bS21 Pseudomonas syringae pv. syringae (strain B728a)
Q88A58 3.4e-33 111 78 0 71 3 rpsU Small ribosomal subunit protein bS21 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3K5S0 3.4e-33 111 78 0 71 3 rpsU Small ribosomal subunit protein bS21 Pseudomonas fluorescens (strain Pf0-1)
Q4K4W3 3.4e-33 111 78 0 71 3 rpsU Small ribosomal subunit protein bS21 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q48NU9 3.4e-33 111 78 0 71 3 rpsU Small ribosomal subunit protein bS21 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q2S8V6 1.2e-32 110 76 0 71 3 rpsU Small ribosomal subunit protein bS21 Hahella chejuensis (strain KCTC 2396)
B3PKA4 2.4e-32 109 74 0 71 3 rpsU Small ribosomal subunit protein bS21 Cellvibrio japonicus (strain Ueda107)
Q1QE88 6.37e-32 108 71 0 71 3 rpsU Small ribosomal subunit protein bS21 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FV74 6.37e-32 108 71 0 71 3 rpsU Small ribosomal subunit protein bS21 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
B0V810 1.06e-31 107 74 0 71 3 rpsU Small ribosomal subunit protein bS21 Acinetobacter baumannii (strain AYE)
A3M6X4 1.06e-31 107 74 0 71 3 rpsU Small ribosomal subunit protein bS21 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VKC6 1.06e-31 107 74 0 71 3 rpsU Small ribosomal subunit protein bS21 Acinetobacter baumannii (strain SDF)
B7I2K7 1.06e-31 107 74 0 71 1 rpsU Small ribosomal subunit protein bS21 Acinetobacter baumannii (strain AB0057)
B7H0A6 1.06e-31 107 74 0 71 3 rpsU Small ribosomal subunit protein bS21 Acinetobacter baumannii (strain AB307-0294)
Q6FCL0 1.06e-31 107 74 0 71 3 rpsU Small ribosomal subunit protein bS21 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q31EM2 1.19e-31 107 74 0 71 3 rpsU Small ribosomal subunit protein bS21 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
B8GPU0 5.07e-31 105 73 0 71 3 rpsU Small ribosomal subunit protein bS21 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
A5WCC4 9.58e-31 105 70 0 71 3 rpsU Small ribosomal subunit protein bS21 Psychrobacter sp. (strain PRwf-1)
A1RMH9 1.16e-30 105 87 0 71 3 rpsU Small ribosomal subunit protein bS21 Shewanella sp. (strain W3-18-1)
Q0HSD4 1.16e-30 105 87 0 71 3 rpsU Small ribosomal subunit protein bS21 Shewanella sp. (strain MR-7)
Q0HG41 1.16e-30 105 87 0 71 3 rpsU Small ribosomal subunit protein bS21 Shewanella sp. (strain MR-4)
A0KZT9 1.16e-30 105 87 0 71 3 rpsU Small ribosomal subunit protein bS21 Shewanella sp. (strain ANA-3)
B8CJF0 1.16e-30 105 85 0 71 3 rpsU Small ribosomal subunit protein bS21 Shewanella piezotolerans (strain WP3 / JCM 13877)
A4Y4F2 1.16e-30 105 87 0 71 3 rpsU Small ribosomal subunit protein bS21 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A8H151 1.16e-30 105 87 0 71 3 rpsU Small ribosomal subunit protein bS21 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
Q8EHD7 1.16e-30 105 87 0 71 3 rpsU Small ribosomal subunit protein bS21 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A3QBM2 1.16e-30 105 87 0 71 3 rpsU Small ribosomal subunit protein bS21 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B0TIN6 1.16e-30 105 87 0 71 3 rpsU Small ribosomal subunit protein bS21 Shewanella halifaxensis (strain HAW-EB4)
Q07YT2 1.16e-30 105 87 0 71 3 rpsU Small ribosomal subunit protein bS21 Shewanella frigidimarina (strain NCIMB 400)
Q12KB6 1.16e-30 105 87 0 71 3 rpsU Small ribosomal subunit protein bS21 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A9L514 1.16e-30 105 87 0 71 3 rpsU Small ribosomal subunit protein bS21 Shewanella baltica (strain OS195)
A6WKK3 1.16e-30 105 87 0 71 3 rpsU Small ribosomal subunit protein bS21 Shewanella baltica (strain OS185)
A3D1Q3 1.16e-30 105 87 0 71 3 rpsU Small ribosomal subunit protein bS21 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EBV6 1.16e-30 105 87 0 71 3 rpsU Small ribosomal subunit protein bS21 Shewanella baltica (strain OS223)
Q0VMU0 2.11e-30 104 73 0 71 3 rpsU Small ribosomal subunit protein bS21 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A1S3S7 2.38e-30 104 85 0 71 3 rpsU Small ribosomal subunit protein bS21 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
B1KHE1 2.63e-30 104 85 0 71 3 rpsU Small ribosomal subunit protein bS21 Shewanella woodyi (strain ATCC 51908 / MS32)
A8FS63 2.63e-30 104 84 0 71 3 rpsU Small ribosomal subunit protein bS21 Shewanella sediminis (strain HAW-EB3)
A5EXR7 1.18e-29 102 71 0 71 3 rpsU Small ribosomal subunit protein bS21 Dichelobacter nodosus (strain VCS1703A)
A4VHG8 1.7e-29 102 78 0 71 3 rpsU Small ribosomal subunit protein bS21 Stutzerimonas stutzeri (strain A1501)
A4XZK7 1.7e-29 102 78 0 71 3 rpsU Small ribosomal subunit protein bS21 Pseudomonas mendocina (strain ymp)
B1JDY6 3.04e-29 101 78 0 71 3 rpsU Small ribosomal subunit protein bS21 Pseudomonas putida (strain W619)
P0A166 3.04e-29 101 78 0 71 3 rpsU Small ribosomal subunit protein bS21 Pseudomonas putida
P0A165 3.04e-29 101 78 0 71 3 rpsU Small ribosomal subunit protein bS21 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KJ81 3.04e-29 101 78 0 71 3 rpsU Small ribosomal subunit protein bS21 Pseudomonas putida (strain GB-1)
A5VXI3 3.04e-29 101 78 0 71 3 rpsU Small ribosomal subunit protein bS21 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q1IG32 3.04e-29 101 78 0 71 3 rpsU Small ribosomal subunit protein bS21 Pseudomonas entomophila (strain L48)
Q602S0 9.74e-29 100 74 0 63 3 rpsU Small ribosomal subunit protein bS21 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
A1AVM7 6.87e-28 98 63 0 71 3 rpsU Small ribosomal subunit protein bS21 Ruthia magnifica subsp. Calyptogena magnifica
Q05I90 1.03e-27 97 67 0 71 3 rpsU Small ribosomal subunit protein bS21 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SLA2 1.03e-27 97 67 0 71 3 rpsU Small ribosomal subunit protein bS21 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NYH0 1.03e-27 97 67 0 71 3 rpsU Small ribosomal subunit protein bS21 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BNE1 1.03e-27 97 67 0 71 3 rpsU Small ribosomal subunit protein bS21 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
P66536 1.03e-27 97 67 0 71 3 rpsU Small ribosomal subunit protein bS21 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RXI3 1.03e-27 97 67 0 71 3 rpsU Small ribosomal subunit protein bS21 Xanthomonas campestris pv. campestris (strain B100)
Q4UPU4 1.03e-27 97 67 0 71 3 rpsU Small ribosomal subunit protein bS21 Xanthomonas campestris pv. campestris (strain 8004)
P66535 1.03e-27 97 67 0 71 3 rpsU Small ribosomal subunit protein bS21 Xanthomonas axonopodis pv. citri (strain 306)
B2FK05 1.03e-27 97 67 0 71 3 rpsU Small ribosomal subunit protein bS21 Stenotrophomonas maltophilia (strain K279a)
B4SHI8 1.03e-27 97 67 0 71 3 rpsU Small ribosomal subunit protein bS21 Stenotrophomonas maltophilia (strain R551-3)
B4RY34 1.23e-27 97 83 0 71 3 rpsU Small ribosomal subunit protein bS21 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
Q3JF12 4.16e-27 96 78 0 71 3 rpsU Small ribosomal subunit protein bS21 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
B0U4B6 4.29e-27 96 66 0 71 3 rpsU Small ribosomal subunit protein bS21 Xylella fastidiosa (strain M12)
Q9PG68 4.29e-27 96 66 0 71 3 rpsU Small ribosomal subunit protein bS21 Xylella fastidiosa (strain 9a5c)
Q87B16 5.9e-27 95 66 0 71 3 rpsU Small ribosomal subunit protein bS21 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I7X5 5.9e-27 95 66 0 71 3 rpsU Small ribosomal subunit protein bS21 Xylella fastidiosa (strain M23)
Q15X21 9.57e-27 95 81 0 71 3 rpsU Small ribosomal subunit protein bS21 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q9I5V8 2.33e-26 94 80 0 71 1 rpsU Small ribosomal subunit protein bS21 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02TI4 2.33e-26 94 80 0 71 3 rpsU Small ribosomal subunit protein bS21 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V4G5 2.33e-26 94 80 0 71 3 rpsU Small ribosomal subunit protein bS21 Pseudomonas aeruginosa (strain LESB58)
A6UZ82 2.33e-26 94 80 0 71 3 rpsU Small ribosomal subunit protein bS21 Pseudomonas aeruginosa (strain PA7)
C1DIY4 2.33e-26 94 80 0 71 3 rpsU Small ribosomal subunit protein bS21 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A5CXJ1 2.46e-26 94 61 0 71 3 rpsU Small ribosomal subunit protein bS21 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
Q47W36 4.16e-26 93 83 0 71 3 rpsU Small ribosomal subunit protein bS21 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q1QYX7 5.02e-26 93 80 0 71 3 rpsU Small ribosomal subunit protein bS21 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A1TYD9 2.6e-25 91 77 0 71 3 rpsU Small ribosomal subunit protein bS21 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
C1DC39 1.15e-24 90 71 0 60 3 rpsU Small ribosomal subunit protein bS21 Laribacter hongkongensis (strain HLHK9)
Q5WU88 6.45e-24 88 64 0 67 3 rpsU Small ribosomal subunit protein bS21 Legionella pneumophila (strain Lens)
Q5ZT07 6.45e-24 88 64 0 67 3 rpsU Small ribosomal subunit protein bS21 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IEG0 6.45e-24 88 64 0 67 3 rpsU Small ribosomal subunit protein bS21 Legionella pneumophila (strain Corby)
Q5X2T0 6.45e-24 88 64 0 67 3 rpsU Small ribosomal subunit protein bS21 Legionella pneumophila (strain Paris)
Q7NRL5 7.85e-24 87 70 0 60 3 rpsU Small ribosomal subunit protein bS21 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A6VU46 1.51e-23 87 77 0 71 3 rpsU Small ribosomal subunit protein bS21 Marinomonas sp. (strain MWYL1)
Q3SGB2 1.58e-23 87 71 0 60 3 rpsU Small ribosomal subunit protein bS21 Thiobacillus denitrificans (strain ATCC 25259)
Q83BB9 2.56e-23 86 62 0 64 3 rpsU Small ribosomal subunit protein bS21 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9N9M4 2.56e-23 86 62 0 64 3 rpsU Small ribosomal subunit protein bS21 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KDP4 2.56e-23 86 62 0 64 3 rpsU Small ribosomal subunit protein bS21 Coxiella burnetii (strain Dugway 5J108-111)
B1XZ34 4.25e-23 85 70 0 60 3 rpsU Small ribosomal subunit protein bS21 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
C5CTG9 1.03e-22 85 68 0 60 3 rpsU Small ribosomal subunit protein bS21 Variovorax paradoxus (strain S110)
A1TNY6 1.03e-22 85 68 0 60 3 rpsU Small ribosomal subunit protein bS21 Paracidovorax citrulli (strain AAC00-1)
A1W9S4 1.03e-22 85 68 0 60 3 rpsU Small ribosomal subunit protein bS21 Acidovorax sp. (strain JS42)
B9MC79 1.03e-22 85 68 0 60 3 rpsU Small ribosomal subunit protein bS21 Acidovorax ebreus (strain TPSY)
A1WM72 1.06e-22 85 68 0 60 3 rpsU Small ribosomal subunit protein bS21 Verminephrobacter eiseniae (strain EF01-2)
Q5NG21 1.3e-22 84 67 0 58 3 rpsU3 Small ribosomal subunit protein bS21C Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14HH3 1.3e-22 84 67 0 58 3 rpsU3 Small ribosomal subunit protein bS21C Francisella tularensis subsp. tularensis (strain FSC 198)
Q0BLW7 1.3e-22 84 67 0 58 3 rpsU2 Small ribosomal subunit protein bS21B Francisella tularensis subsp. holarctica (strain OSU18)
Q2A3F5 1.3e-22 84 67 0 58 3 rpsU2 Small ribosomal subunit protein bS21B Francisella tularensis subsp. holarctica (strain LVS)
Q393P8 1.47e-22 84 66 0 60 3 rpsU Small ribosomal subunit protein bS21 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q1BLZ1 1.47e-22 84 66 0 60 3 rpsU1 Small ribosomal subunit protein bS21A Burkholderia orbicola (strain AU 1054)
Q7VWM3 1.52e-22 84 59 1 71 3 rpsU Small ribosomal subunit protein bS21 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
A9IK87 1.52e-22 84 59 1 71 3 rpsU Small ribosomal subunit protein bS21 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q7W6Q9 1.52e-22 84 59 1 71 3 rpsU Small ribosomal subunit protein bS21 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WHP3 1.52e-22 84 59 1 71 3 rpsU Small ribosomal subunit protein bS21 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q62DT5 1.52e-22 84 66 0 60 3 rpsU2 Small ribosomal subunit protein bS21B Burkholderia mallei (strain ATCC 23344)
Q63JF8 1.52e-22 84 66 0 60 3 rpsU3 Small ribosomal subunit protein bS21C Burkholderia pseudomallei (strain K96243)
Q3JKA9 1.52e-22 84 66 0 60 3 rpsU3 Small ribosomal subunit protein bS21C Burkholderia pseudomallei (strain 1710b)
Q2T7N1 1.54e-22 84 66 0 60 3 rpsU2 Small ribosomal subunit protein bS21B Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2KYB0 1.91e-22 84 63 0 60 3 rpsU Small ribosomal subunit protein bS21 Bordetella avium (strain 197N)
Q47IP5 2.84e-22 84 68 0 60 3 rpsU Small ribosomal subunit protein bS21 Dechloromonas aromatica (strain RCB)
A2SF60 2.96e-22 84 66 0 60 3 rpsU Small ribosomal subunit protein bS21 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q13RW7 4.03e-22 83 66 0 60 3 rpsU2 Small ribosomal subunit protein bS21B Paraburkholderia xenovorans (strain LB400)
B5ELK7 5.56e-22 83 69 0 71 3 rpsU Small ribosomal subunit protein bS21 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7J6A7 5.56e-22 83 69 0 71 3 rpsU Small ribosomal subunit protein bS21 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
Q82XN1 5.79e-22 83 66 0 60 3 rpsU Small ribosomal subunit protein bS21 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q0AJ90 5.79e-22 83 66 0 60 3 rpsU Small ribosomal subunit protein bS21 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A1KAI5 6.98e-22 82 68 0 60 3 rpsU Small ribosomal subunit protein bS21 Azoarcus sp. (strain BH72)
A1KW26 7.96e-22 82 68 0 60 3 rpsU Small ribosomal subunit protein bS21 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P66519 7.96e-22 82 68 0 60 1 rpsU Small ribosomal subunit protein bS21 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66518 7.96e-22 82 68 0 60 3 rpsU Small ribosomal subunit protein bS21 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9M105 7.96e-22 82 68 0 60 3 rpsU Small ribosomal subunit protein bS21 Neisseria meningitidis serogroup C (strain 053442)
B4RRF0 7.96e-22 82 68 0 60 3 rpsU Small ribosomal subunit protein bS21 Neisseria gonorrhoeae (strain NCCP11945)
Q5F506 7.96e-22 82 68 0 60 3 rpsU Small ribosomal subunit protein bS21 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q21UF7 9.28e-22 82 66 0 60 3 rpsU Small ribosomal subunit protein bS21 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A9BTN3 9.8e-22 82 65 0 60 3 rpsU Small ribosomal subunit protein bS21 Delftia acidovorans (strain DSM 14801 / SPH-1)
Q5P262 1.18e-21 82 66 0 60 3 rpsU Small ribosomal subunit protein bS21 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q127U4 2.18e-21 81 65 0 60 3 rpsU Small ribosomal subunit protein bS21 Polaromonas sp. (strain JS666 / ATCC BAA-500)
A1VM24 2.18e-21 81 65 0 60 3 rpsU Small ribosomal subunit protein bS21 Polaromonas naphthalenivorans (strain CJ2)
Q1GYU5 5.79e-21 80 57 1 71 3 rpsU Small ribosomal subunit protein bS21 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q2Y7B7 9.59e-21 80 66 0 60 3 rpsU Small ribosomal subunit protein bS21 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A6SV83 1.39e-20 79 61 0 60 3 rpsU Small ribosomal subunit protein bS21 Janthinobacterium sp. (strain Marseille)
A4G2B9 1.39e-20 79 61 0 60 3 rpsU Small ribosomal subunit protein bS21 Herminiimonas arsenicoxydans
Q1LK40 8.32e-20 77 63 0 60 3 rpsU2 Small ribosomal subunit protein bS21B Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B3E615 1.2e-19 77 59 0 59 3 rpsU Small ribosomal subunit protein bS21 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
Q13SW3 3.58e-19 76 61 0 60 3 rpsU1 Small ribosomal subunit protein bS21A Paraburkholderia xenovorans (strain LB400)
A2S6T3 6.18e-19 75 61 0 60 3 rpsU Small ribosomal subunit protein bS21 Burkholderia mallei (strain NCTC 10229)
Q9WW25 6.18e-19 75 61 0 60 3 rpsU1 Small ribosomal subunit protein bS21A Burkholderia mallei (strain ATCC 23344)
Q2STR0 6.18e-19 75 61 0 60 3 rpsU1 Small ribosomal subunit protein bS21A Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
P0DML1 6.18e-19 75 61 0 60 3 rpsU1 Small ribosomal subunit protein bS21A Burkholderia pseudomallei (strain K96243)
P0DML0 6.18e-19 75 61 0 60 3 rpsU1 Small ribosomal subunit protein bS21A Burkholderia pseudomallei (strain 1026b)
Q3JY47 6.18e-19 75 61 0 60 3 rpsU1 Small ribosomal subunit protein bS21A Burkholderia pseudomallei (strain 1710b)
A1ATH8 1.53e-17 72 55 0 59 3 rpsU Small ribosomal subunit protein bS21 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q748B4 6.01e-17 70 55 0 59 3 rpsU2 Small ribosomal subunit protein bS21B Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
B8I406 4.79e-16 67 60 0 55 3 rpsU Small ribosomal subunit protein bS21 Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
B2U814 6.23e-16 67 56 0 60 3 rpsU Small ribosomal subunit protein bS21 Ralstonia pickettii (strain 12J)
Q8Y3H2 6.23e-16 67 56 0 60 3 rpsU Small ribosomal subunit protein bS21 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A0Q1Q8 7.53e-16 67 56 0 58 3 rpsU Small ribosomal subunit protein bS21 Clostridium novyi (strain NT)
Q1BIU1 9.55e-16 67 60 0 56 3 rpsU2 Small ribosomal subunit protein bS21B Burkholderia orbicola (strain AU 1054)
Q39YP0 1.38e-15 67 64 0 42 3 rpsU Small ribosomal subunit protein bS21 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A4J7E7 1.4e-15 66 60 0 55 3 rpsU Small ribosomal subunit protein bS21 Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
A5G8S7 1.57e-15 66 64 0 42 3 rpsU Small ribosomal subunit protein bS21 Geotalea uraniireducens (strain Rf4)
C6E7F2 1.57e-15 66 64 0 42 3 rpsU Small ribosomal subunit protein bS21 Geobacter sp. (strain M21)
B5EDR2 1.57e-15 66 64 0 42 3 rpsU Small ribosomal subunit protein bS21 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
B1XVZ1 5.21e-15 65 63 0 60 3 rpsU Small ribosomal subunit protein bS21 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
A4SZK0 5.21e-15 65 63 0 60 3 rpsU Small ribosomal subunit protein bS21 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
A3DF51 5.34e-15 65 58 0 55 3 rpsU Small ribosomal subunit protein bS21 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
B9M0M2 6.91e-15 65 61 0 42 3 rpsU Small ribosomal subunit protein bS21 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
C0QTB8 7.24e-15 65 50 0 64 3 rpsU Small ribosomal subunit protein bS21 Persephonella marina (strain DSM 14350 / EX-H1)
Q182D5 7.35e-15 65 50 0 59 3 rpsU Small ribosomal subunit protein bS21 Clostridioides difficile (strain 630)
Q0SRF3 1.05e-14 64 58 0 55 3 rpsU Small ribosomal subunit protein bS21 Clostridium perfringens (strain SM101 / Type A)
Q8XIU0 1.05e-14 64 58 0 55 3 rpsU Small ribosomal subunit protein bS21 Clostridium perfringens (strain 13 / Type A)
Q0TNT7 1.05e-14 64 58 0 55 3 rpsU Small ribosomal subunit protein bS21 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q2RKW9 1.18e-14 64 56 0 55 3 rpsU Small ribosomal subunit protein bS21 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q3AF02 1.33e-14 64 59 1 52 3 rpsU Small ribosomal subunit protein bS21 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q97JJ2 1.51e-14 63 60 0 55 3 rpsU Small ribosomal subunit protein bS21 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q2T6K1 1.68e-14 64 56 0 62 3 rpsU3 Small ribosomal subunit protein bS21C Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q24ST0 2.01e-14 63 56 0 55 3 rpsU Small ribosomal subunit protein bS21 Desulfitobacterium hafniense (strain Y51)
B8FUM7 2.01e-14 63 56 0 55 3 rpsU Small ribosomal subunit protein bS21 Desulfitobacterium hafniense (strain DSM 10664 / DCB-2)
Q5NHQ7 2.16e-14 63 60 0 55 3 rpsU1 Small ribosomal subunit protein bS21A Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14J59 2.16e-14 63 60 0 55 3 rpsU1 Small ribosomal subunit protein bS21A Francisella tularensis subsp. tularensis (strain FSC 198)
Q0BN93 2.23e-14 63 58 0 55 3 rpsU1 Small ribosomal subunit protein bS21A Francisella tularensis subsp. holarctica (strain OSU18)
Q2A4X4 2.23e-14 63 58 0 55 3 rpsU1 Small ribosomal subunit protein bS21A Francisella tularensis subsp. holarctica (strain LVS)
A5N6M8 2.53e-14 63 60 0 55 3 rpsU Small ribosomal subunit protein bS21 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E047 2.53e-14 63 60 0 55 3 rpsU Small ribosomal subunit protein bS21 Clostridium kluyveri (strain NBRC 12016)
A8MG57 2.83e-14 63 65 0 43 3 rpsU Small ribosomal subunit protein bS21 Alkaliphilus oremlandii (strain OhILAs)
B0K6Z9 3.95e-14 63 55 0 58 3 rpsU Small ribosomal subunit protein bS21 Thermoanaerobacter sp. (strain X514)
B0KA63 3.95e-14 63 55 0 58 3 rpsU Small ribosomal subunit protein bS21 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
C4ZAS2 4.78e-14 62 54 0 55 3 rpsU Small ribosomal subunit protein bS21 Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
Q62CJ3 5.49e-14 63 54 0 62 3 rpsU3 Small ribosomal subunit protein bS21C Burkholderia mallei (strain ATCC 23344)
Q63KJ7 5.49e-14 63 54 0 62 3 rpsU2 Small ribosomal subunit protein bS21B Burkholderia pseudomallei (strain K96243)
Q3JLK5 5.49e-14 63 54 0 62 3 rpsU2 Small ribosomal subunit protein bS21B Burkholderia pseudomallei (strain 1710b)
Q04F79 7.26e-14 62 54 1 64 3 rpsU Small ribosomal subunit protein bS21 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
A9KMW6 7.57e-14 62 54 0 55 3 rpsU Small ribosomal subunit protein bS21 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q8RB59 9.18e-14 62 53 0 58 3 rpsU Small ribosomal subunit protein bS21 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
C4Z055 9.33e-14 62 54 0 55 3 rpsU Small ribosomal subunit protein bS21 Lachnospira eligens (strain ATCC 27750 / DSM 3376 / VPI C15-48 / C15-B4)
Q6MR60 1.49e-13 61 47 0 59 3 rpsU Small ribosomal subunit protein bS21 Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q67S44 2.37e-13 61 52 0 55 3 rpsU Small ribosomal subunit protein bS21 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
B9DRV3 2.45e-13 60 60 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
P0DE87 2.45e-13 60 60 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48UB6 2.45e-13 60 60 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RFA6 2.45e-13 60 60 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J7E2 2.45e-13 60 60 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JHL9 2.45e-13 60 60 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JMH3 2.45e-13 60 60 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1JCJ5 2.45e-13 60 60 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus pyogenes serotype M12 (strain MGAS2096)
P66528 2.45e-13 60 60 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5XCW4 2.45e-13 60 60 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DE86 2.45e-13 60 60 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P66526 2.45e-13 60 60 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus pyogenes serotype M1
P66531 2.45e-13 60 60 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P66530 2.45e-13 60 60 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P66529 2.45e-13 60 60 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus agalactiae serotype III (strain NEM316)
Q3K081 2.45e-13 60 60 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
Q5M3E1 2.79e-13 60 60 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LYS8 2.79e-13 60 60 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus thermophilus (strain CNRZ 1066)
A6TSL4 3.7e-13 60 60 0 43 3 rpsU Small ribosomal subunit protein bS21 Alkaliphilus metalliredigens (strain QYMF)
A4XKI3 4.62e-13 60 54 1 55 3 rpsU Small ribosomal subunit protein bS21 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
B9MRR4 4.62e-13 60 54 1 55 3 rpsU Small ribosomal subunit protein bS21 Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q831T3 4.93e-13 60 58 0 55 3 rpsU Small ribosomal subunit protein bS21 Enterococcus faecalis (strain ATCC 700802 / V583)
A3CM46 5.75e-13 60 58 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus sanguinis (strain SK36)
A8AXP8 5.75e-13 60 58 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
Q03JL0 6.14e-13 60 58 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q032K8 6.35e-13 60 58 0 55 3 rpsU Small ribosomal subunit protein bS21 Lactococcus lactis subsp. cremoris (strain SK11)
A2RHW9 6.35e-13 60 58 0 55 1 rpsU Small ribosomal subunit protein bS21 Lactococcus lactis subsp. cremoris (strain MG1363)
Q9CIW6 6.35e-13 60 58 0 55 3 rpsU Small ribosomal subunit protein bS21 Lactococcus lactis subsp. lactis (strain IL1403)
Q1WU25 9.46e-13 59 54 0 59 3 rpsU Small ribosomal subunit protein bS21 Ligilactobacillus salivarius (strain UCC118)
B2A1N7 9.61e-13 59 57 0 47 3 rpsU Small ribosomal subunit protein bS21 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q8DMS3 1.61e-12 58 51 0 56 3 rpsU Small ribosomal subunit protein bS21 Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
B2TM09 1.72e-12 58 56 0 55 3 rpsU Small ribosomal subunit protein bS21 Clostridium botulinum (strain Eklund 17B / Type B)
B2V2J3 1.72e-12 58 56 0 55 3 rpsU Small ribosomal subunit protein bS21 Clostridium botulinum (strain Alaska E43 / Type E3)
B1I693 1.72e-12 58 50 0 55 3 rpsU Small ribosomal subunit protein bS21 Desulforudis audaxviator (strain MP104C)
Q9KD65 1.74e-12 58 56 0 55 3 rpsU Small ribosomal subunit protein bS21 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q5KX04 1.79e-12 58 56 0 55 3 rpsU Small ribosomal subunit protein bS21 Geobacillus kaustophilus (strain HTA426)
C1CQU3 1.8e-12 58 58 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CLC2 1.8e-12 58 58 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus pneumoniae (strain P1031)
C1CF02 1.8e-12 58 58 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus pneumoniae (strain JJA)
P66525 1.8e-12 58 58 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P66524 1.8e-12 58 58 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
B8ZKX3 1.8e-12 58 58 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1ICL4 1.8e-12 58 58 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus pneumoniae (strain Hungary19A-6)
C1C813 1.8e-12 58 58 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus pneumoniae (strain 70585)
B5E5S2 1.8e-12 58 58 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus pneumoniae serotype 19F (strain G54)
Q04JT6 1.8e-12 58 58 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
B1KZN1 1.98e-12 58 56 0 55 3 rpsU Small ribosomal subunit protein bS21 Clostridium botulinum (strain Loch Maree / Type A3)
A7GHH0 1.98e-12 58 56 0 55 3 rpsU Small ribosomal subunit protein bS21 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1ILL7 1.98e-12 58 56 0 55 3 rpsU Small ribosomal subunit protein bS21 Clostridium botulinum (strain Okra / Type B1)
C1FVT4 1.98e-12 58 56 0 55 3 rpsU Small ribosomal subunit protein bS21 Clostridium botulinum (strain Kyoto / Type A2)
A5I634 1.98e-12 58 56 0 55 3 rpsU Small ribosomal subunit protein bS21 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
C3L3G1 1.98e-12 58 56 0 55 3 rpsU Small ribosomal subunit protein bS21 Clostridium botulinum (strain 657 / Type Ba4)
A7FXK9 1.98e-12 58 56 0 55 3 rpsU Small ribosomal subunit protein bS21 Clostridium botulinum (strain ATCC 19397 / Type A)
P23829 2.11e-12 58 60 0 50 1 rpsU Small ribosomal subunit protein bS21 Geobacillus stearothermophilus
C5D4T4 2.14e-12 58 56 0 55 3 rpsU Small ribosomal subunit protein bS21 Geobacillus sp. (strain WCH70)
Q03F58 2.18e-12 58 54 0 59 3 rpsU Small ribosomal subunit protein bS21 Pediococcus pentosaceus (strain ATCC 25745 / CCUG 21536 / LMG 10740 / 183-1w)
A7GT03 2.66e-12 58 56 0 55 3 rpsU Small ribosomal subunit protein bS21 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
A9VHT6 2.78e-12 58 56 0 55 3 rpsU Small ribosomal subunit protein bS21 Bacillus mycoides (strain KBAB4)
Q6HDL2 2.78e-12 58 56 0 55 3 rpsU Small ribosomal subunit protein bS21 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q634N2 2.78e-12 58 56 0 55 3 rpsU Small ribosomal subunit protein bS21 Bacillus cereus (strain ZK / E33L)
B9IY76 2.78e-12 58 56 0 55 3 rpsU Small ribosomal subunit protein bS21 Bacillus cereus (strain Q1)
B7HPK8 2.78e-12 58 56 0 55 3 rpsU Small ribosomal subunit protein bS21 Bacillus cereus (strain AH187)
B7HCT4 2.78e-12 58 56 0 55 3 rpsU Small ribosomal subunit protein bS21 Bacillus cereus (strain B4264)
C1ESK3 2.78e-12 58 56 0 55 3 rpsU Small ribosomal subunit protein bS21 Bacillus cereus (strain 03BB102)
B7IYG2 2.78e-12 58 56 0 55 3 rpsU Small ribosomal subunit protein bS21 Bacillus cereus (strain G9842)
Q730M6 2.78e-12 58 56 0 55 3 rpsU Small ribosomal subunit protein bS21 Bacillus cereus (strain ATCC 10987 / NRS 248)
B7JN34 2.78e-12 58 56 0 55 3 rpsU Small ribosomal subunit protein bS21 Bacillus cereus (strain AH820)
Q81LS7 2.78e-12 58 56 0 55 3 rpsU Small ribosomal subunit protein bS21 Bacillus anthracis
C3L5R2 2.78e-12 58 56 0 55 3 rpsU Small ribosomal subunit protein bS21 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P8L5 2.78e-12 58 56 0 55 3 rpsU Small ribosomal subunit protein bS21 Bacillus anthracis (strain A0248)
Q4L6S5 3.39e-12 58 53 0 58 3 rpsU Small ribosomal subunit protein bS21 Staphylococcus haemolyticus (strain JCSC1435)
P66523 3.39e-12 58 53 0 58 3 rpsU Small ribosomal subunit protein bS21 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HNX1 3.39e-12 58 53 0 58 3 rpsU Small ribosomal subunit protein bS21 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
B9DNM1 3.39e-12 58 53 0 58 3 rpsU Small ribosomal subunit protein bS21 Staphylococcus carnosus (strain TM300)
P66522 3.39e-12 58 53 0 58 3 rpsU Small ribosomal subunit protein bS21 Staphylococcus aureus (strain MW2)
A8Z4B4 3.39e-12 58 53 0 58 3 rpsU Small ribosomal subunit protein bS21 Staphylococcus aureus (strain USA300 / TCH1516)
Q6G8Z2 3.39e-12 58 53 0 58 3 rpsU Small ribosomal subunit protein bS21 Staphylococcus aureus (strain MSSA476)
Q6GGC5 3.39e-12 58 53 0 58 3 rpsU Small ribosomal subunit protein bS21 Staphylococcus aureus (strain MRSA252)
P66521 3.39e-12 58 53 0 58 1 rpsU Small ribosomal subunit protein bS21 Staphylococcus aureus (strain N315)
P66520 3.39e-12 58 53 0 58 3 rpsU Small ribosomal subunit protein bS21 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QHB8 3.39e-12 58 53 0 58 3 rpsU Small ribosomal subunit protein bS21 Staphylococcus aureus (strain Newman)
Q5HFI5 3.39e-12 58 53 0 58 3 rpsU Small ribosomal subunit protein bS21 Staphylococcus aureus (strain COL)
Q2YT04 3.39e-12 58 53 0 58 1 rpsU Small ribosomal subunit protein bS21 Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5ITA3 3.39e-12 58 53 0 58 3 rpsU Small ribosomal subunit protein bS21 Staphylococcus aureus (strain JH9)
Q2FXZ7 3.39e-12 58 53 0 58 1 rpsU Small ribosomal subunit protein bS21 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FGE8 3.39e-12 58 53 0 58 3 rpsU Small ribosomal subunit protein bS21 Staphylococcus aureus (strain USA300)
A6U247 3.39e-12 58 53 0 58 3 rpsU Small ribosomal subunit protein bS21 Staphylococcus aureus (strain JH1)
A7X2X5 3.39e-12 58 53 0 58 3 rpsU Small ribosomal subunit protein bS21 Staphylococcus aureus (strain Mu3 / ATCC 700698)
B1MYA3 5e-12 57 52 0 59 3 rpsU Small ribosomal subunit protein bS21 Leuconostoc citreum (strain KM20)
B5XKR6 5.49e-12 57 58 0 55 3 rpsU Small ribosomal subunit protein bS21 Streptococcus pyogenes serotype M49 (strain NZ131)
Q5WHF1 6.12e-12 57 54 0 55 3 rpsU Small ribosomal subunit protein bS21 Shouchella clausii (strain KSM-K16)
Q1D1W9 6.4e-12 57 57 0 42 3 rpsU Small ribosomal subunit protein bS21 Myxococcus xanthus (strain DK1622)
P49225 6.4e-12 57 57 0 42 3 rpsU Small ribosomal subunit protein bS21 Myxococcus xanthus
A9B119 6.48e-12 57 49 1 63 3 rpsU Small ribosomal subunit protein bS21 Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
Q3M4Y3 7.88e-12 57 50 1 58 3 rpsU1 Small ribosomal subunit protein bS21A Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q38XA7 8.32e-12 57 60 0 50 3 rpsU Small ribosomal subunit protein bS21 Latilactobacillus sakei subsp. sakei (strain 23K)
Q8YVM0 9.7e-12 57 50 1 58 3 rpsU3 Small ribosomal subunit protein bS21C Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
B1HTK2 9.9e-12 57 52 0 55 3 rpsU Small ribosomal subunit protein bS21 Lysinibacillus sphaericus (strain C3-41)
Q038S6 1.02e-11 57 54 1 53 3 rpsU Small ribosomal subunit protein bS21 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WEL7 1.02e-11 57 54 1 53 3 rpsU Small ribosomal subunit protein bS21 Lacticaseibacillus casei (strain BL23)
B4UDK2 1.04e-11 57 51 0 43 3 rpsU Small ribosomal subunit protein bS21 Anaeromyxobacter sp. (strain K)
Q2INW0 1.04e-11 57 51 0 43 3 rpsU Small ribosomal subunit protein bS21 Anaeromyxobacter dehalogenans (strain 2CP-C)
B8JDL4 1.04e-11 57 51 0 43 3 rpsU Small ribosomal subunit protein bS21 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
A7H8C5 1.13e-11 57 51 0 43 3 rpsU Small ribosomal subunit protein bS21 Anaeromyxobacter sp. (strain Fw109-5)
A7Z6V5 1.29e-11 56 54 0 55 3 rpsU Small ribosomal subunit protein bS21 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
P21478 1.29e-11 56 54 0 55 1 rpsU Small ribosomal subunit protein bS21 Bacillus subtilis (strain 168)
A8FFC6 1.29e-11 56 54 0 55 3 rpsU Small ribosomal subunit protein bS21 Bacillus pumilus (strain SAFR-032)
Q03WM2 1.37e-11 56 50 0 59 3 rpsU Small ribosomal subunit protein bS21 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
B5YKU0 1.42e-11 56 46 0 47 3 rpsU Small ribosomal subunit protein bS21 Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87)
Q65H61 1.47e-11 56 54 0 55 3 rpsU Small ribosomal subunit protein bS21 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
Q74IY5 1.75e-11 56 58 0 50 3 rpsU Small ribosomal subunit protein bS21 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q5MZL2 2.38e-11 55 57 0 47 3 rpsU Small ribosomal subunit protein bS21 Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31MB5 2.38e-11 55 57 0 47 3 rpsU Small ribosomal subunit protein bS21 Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
C0ZB72 2.57e-11 55 50 0 55 3 rpsU Small ribosomal subunit protein bS21 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
C1A4B1 2.67e-11 55 45 0 55 3 rpsU Small ribosomal subunit protein bS21 Gemmatimonas aurantiaca (strain DSM 14586 / JCM 11422 / NBRC 100505 / T-27)
A8YVN1 2.69e-11 55 58 0 50 3 rpsU Small ribosomal subunit protein bS21 Lactobacillus helveticus (strain DPC 4571)
Q04A16 2.69e-11 55 58 0 50 3 rpsU Small ribosomal subunit protein bS21 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1G9W2 2.69e-11 55 58 0 50 3 rpsU Small ribosomal subunit protein bS21 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q5FJT3 2.69e-11 55 58 0 50 3 rpsU Small ribosomal subunit protein bS21 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q88VR5 2.73e-11 55 59 1 47 3 rpsU Small ribosomal subunit protein bS21 Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
A0AIS0 2.9e-11 55 52 0 55 3 rpsU Small ribosomal subunit protein bS21 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
P0DJP1 2.9e-11 55 52 0 55 3 rpsU Small ribosomal subunit protein bS21 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DE42 2.9e-11 55 52 0 55 3 rpsU Small ribosomal subunit protein bS21 Listeria monocytogenes serotype 4a (strain HCC23)
Q71ZK1 2.9e-11 55 52 0 55 3 rpsU Small ribosomal subunit protein bS21 Listeria monocytogenes serotype 4b (strain F2365)
C1KVB6 2.9e-11 55 52 0 55 3 rpsU Small ribosomal subunit protein bS21 Listeria monocytogenes serotype 4b (strain CLIP80459)
G2K042 2.9e-11 55 52 0 55 3 rpsU Small ribosomal subunit protein bS21 Listeria monocytogenes serotype 1/2a (strain 10403S)
P0A4C0 2.9e-11 55 52 0 55 3 rpsU Small ribosomal subunit protein bS21 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q49Y18 2.96e-11 55 52 0 53 3 rpsU Small ribosomal subunit protein bS21 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q7NHA1 3.16e-11 55 49 0 55 3 rpsU2 Small ribosomal subunit protein bS21B Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q03SD5 4.57e-11 55 60 1 45 3 rpsU Small ribosomal subunit protein bS21 Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947)
B1GZP2 4.67e-11 55 50 0 46 3 rpsU Small ribosomal subunit protein bS21 Endomicrobium trichonymphae
C4XS35 6.25e-11 55 47 0 44 3 rpsU Small ribosomal subunit protein bS21 Solidesulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1)
Q8EPW9 7.04e-11 54 52 0 53 3 rpsU Small ribosomal subunit protein bS21 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q8F418 9.63e-11 54 45 0 48 3 rpsU Small ribosomal subunit protein bS21 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72RP1 9.63e-11 54 45 0 48 3 rpsU Small ribosomal subunit protein bS21 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q051D8 9.63e-11 54 45 0 48 3 rpsU Small ribosomal subunit protein bS21 Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04T16 9.63e-11 54 45 0 48 3 rpsU Small ribosomal subunit protein bS21 Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
C6BSW6 1.15e-10 54 48 0 43 3 rpsU Small ribosomal subunit protein bS21 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
B2G6Y3 1.24e-10 54 58 0 46 3 rpsU Small ribosomal subunit protein bS21 Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VJG8 1.24e-10 54 58 0 46 3 rpsU Small ribosomal subunit protein bS21 Limosilactobacillus reuteri (strain DSM 20016)
Q0BL76 1.67e-10 53 55 0 45 3 rpsU3 Small ribosomal subunit protein bS21C Francisella tularensis subsp. holarctica (strain OSU18)
Q2A2N1 1.67e-10 53 55 0 45 3 rpsU3 Small ribosomal subunit protein bS21C Francisella tularensis subsp. holarctica (strain LVS)
Q5NGS8 1.67e-10 53 55 0 45 3 rpsU2 Small ribosomal subunit protein bS21B Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14I80 1.67e-10 53 55 0 45 3 rpsU2 Small ribosomal subunit protein bS21B Francisella tularensis subsp. tularensis (strain FSC 198)
B8DKM6 1.69e-10 53 51 1 45 3 rpsU Small ribosomal subunit protein bS21 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
A0RM99 1.8e-10 53 48 0 60 3 rpsU Small ribosomal subunit protein bS21 Campylobacter fetus subsp. fetus (strain 82-40)
B4U8H0 1.91e-10 53 43 0 60 3 rpsU Small ribosomal subunit protein bS21 Hydrogenobaculum sp. (strain Y04AAS1)
Q30ZP3 2.18e-10 53 51 1 45 3 rpsU Small ribosomal subunit protein bS21 Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
A1VD68 2.3e-10 53 48 1 45 3 rpsU Small ribosomal subunit protein bS21 Nitratidesulfovibrio vulgaris (strain DP4)
B8IZR8 2.43e-10 53 49 1 65 3 rpsU Small ribosomal subunit protein bS21 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q5HW97 2.73e-10 53 48 0 60 3 rpsU Small ribosomal subunit protein bS21 Campylobacter jejuni (strain RM1221)
A1VY90 2.73e-10 53 48 0 60 3 rpsU Small ribosomal subunit protein bS21 Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
Q9PID2 2.73e-10 53 48 0 60 3 rpsU Small ribosomal subunit protein bS21 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A7H506 2.73e-10 53 48 0 60 3 rpsU Small ribosomal subunit protein bS21 Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A8FKF8 2.73e-10 53 48 0 60 3 rpsU Small ribosomal subunit protein bS21 Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)
A7GW82 3.5e-10 53 46 0 60 3 rpsU Small ribosomal subunit protein bS21 Campylobacter curvus (strain 525.92)
B2GBY9 3.61e-10 53 56 0 46 3 rpsU Small ribosomal subunit protein bS21 Limosilactobacillus fermentum (strain NBRC 3956 / LMG 18251)
Q0AWM8 8.17e-10 52 57 0 38 3 rpsU Small ribosomal subunit protein bS21 Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
Q72B46 8.22e-10 52 46 1 45 3 rpsU Small ribosomal subunit protein bS21 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A7HZH0 8.4e-10 52 48 0 60 3 rpsU Small ribosomal subunit protein bS21 Campylobacter hominis (strain ATCC BAA-381 / DSM 21671 / CCUG 45161 / LMG 19568 / NCTC 13146 / CH001A)
B2RZW7 8.95e-10 52 41 0 60 3 rpsU Small ribosomal subunit protein bS21 Borrelia hermsii (strain HS1 / DAH)
B5RL82 8.95e-10 52 41 0 60 3 rpsU Small ribosomal subunit protein bS21 Borrelia duttonii (strain Ly)
Q662A9 1.09e-09 52 41 0 60 3 rpsU Small ribosomal subunit protein bS21 Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
B7J1I4 1.09e-09 52 41 0 60 3 rpsU Small ribosomal subunit protein bS21 Borreliella burgdorferi (strain ZS7)
O51271 1.09e-09 52 41 0 60 1 rpsU Small ribosomal subunit protein bS21 Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q0SNQ5 1.09e-09 52 41 0 60 3 rpsU Small ribosomal subunit protein bS21 Borreliella afzelii (strain PKo)
Q11PN0 1.66e-09 51 53 0 43 3 rpsU Small ribosomal subunit protein bS21 Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
B8E0F9 1.94e-09 51 46 0 47 3 rpsU Small ribosomal subunit protein bS21 Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
B5YET6 1.94e-09 51 46 0 47 3 rpsU Small ribosomal subunit protein bS21 Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
Q9ZLR9 3.11e-09 50 48 0 60 3 rpsU Small ribosomal subunit protein bS21 Helicobacter pylori (strain J99 / ATCC 700824)
Q46YX7 3.63e-09 50 45 0 60 3 rpsU Small ribosomal subunit protein bS21 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q1LKJ4 3.63e-09 50 45 0 60 3 rpsU1 Small ribosomal subunit protein bS21A Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B3EUG8 3.93e-09 50 40 1 62 3 rpsU Small ribosomal subunit protein bS21 Amoebophilus asiaticus (strain 5a2)
B2KBX0 6.86e-09 50 52 0 46 3 rpsU Small ribosomal subunit protein bS21 Elusimicrobium minutum (strain Pei191)
Q73JR1 8.22e-09 49 44 0 47 3 rpsU Small ribosomal subunit protein bS21 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
B2S3Z7 9.89e-09 49 40 2 71 3 rpsU Small ribosomal subunit protein bS21 Treponema pallidum subsp. pallidum (strain SS14)
O83739 9.89e-09 49 40 2 71 3 rpsU Small ribosomal subunit protein bS21 Treponema pallidum (strain Nichols)
B0S1F2 1.17e-08 49 57 0 38 3 rpsU Small ribosomal subunit protein bS21 Finegoldia magna (strain ATCC 29328 / DSM 20472 / WAL 2508)
B1VAH9 3.44e-08 48 50 0 51 3 rpsU Small ribosomal subunit protein bS21 Phytoplasma australiense
Q92M03 4.61e-08 48 46 3 67 3 rpsU2 Small ribosomal subunit protein bS21B Rhizobium meliloti (strain 1021)
A6Q194 6.19e-08 47 43 0 60 3 rpsU Small ribosomal subunit protein bS21 Nitratiruptor sp. (strain SB155-2)
P48949 6.42e-08 47 41 0 51 3 rpsU Small ribosomal subunit protein bS21 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q2K474 8.13e-08 47 44 3 70 3 rpsU2 Small ribosomal subunit protein bS21B Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q1MBR4 8.5e-08 47 44 3 70 3 rpsU2 Small ribosomal subunit protein bS21B Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q3M4P1 8.52e-08 47 49 1 55 3 rpsU2 Small ribosomal subunit protein bS21B Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q8U8M6 1.04e-07 47 44 3 70 3 rpsU1 Small ribosomal subunit protein bS21A Agrobacterium fabrum (strain C58 / ATCC 33970)
B9L7R8 1.08e-07 47 40 0 60 3 rpsU Small ribosomal subunit protein bS21 Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH)
B1XPL6 1.93e-07 46 46 0 47 3 rpsU Small ribosomal subunit protein bS21 Picosynechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6)
B3EGN5 2.26e-07 46 40 1 64 3 rpsU Small ribosomal subunit protein bS21 Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Q6YPV2 2.99e-07 45 50 0 46 3 rpsU Small ribosomal subunit protein bS21 Onion yellows phytoplasma (strain OY-M)
Q2NK14 2.99e-07 45 50 0 46 3 rpsU Small ribosomal subunit protein bS21 Aster yellows witches'-broom phytoplasma (strain AYWB)
Q6G512 3.33e-07 45 44 3 70 3 rpsU Small ribosomal subunit protein bS21 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
B3QZC8 4.54e-07 45 40 1 64 3 rpsU Small ribosomal subunit protein bS21 Chloroherpeton thalassium (strain ATCC 35110 / GB-78)
Q6G0U2 4.56e-07 45 42 3 70 3 rpsU Small ribosomal subunit protein bS21 Bartonella quintana (strain Toulouse)
Q8YYK5 4.89e-07 45 47 1 55 3 rpsU2 Small ribosomal subunit protein bS21B Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q3ZZ95 5.23e-07 45 43 1 62 3 rpsU Small ribosomal subunit protein bS21 Dehalococcoides mccartyi (strain CBDB1)
A5FSB3 5.23e-07 45 43 1 62 3 rpsU Small ribosomal subunit protein bS21 Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
Q3Z9K2 5.23e-07 45 43 1 62 3 rpsU Small ribosomal subunit protein bS21 Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q2JM43 6.16e-07 45 44 1 59 3 rpsU Small ribosomal subunit protein bS21 Synechococcus sp. (strain JA-2-3B'a(2-13))
Q6ME08 7.25e-07 44 38 1 59 3 rpsU Small ribosomal subunit protein bS21 Protochlamydia amoebophila (strain UWE25)
A8LLI5 7.35e-07 45 42 2 64 3 rpsU Small ribosomal subunit protein bS21 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
B0JIQ1 7.57e-07 44 43 0 41 3 rpsU Small ribosomal subunit protein bS21 Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q11B64 7.6e-07 45 45 3 71 3 rpsU2 Small ribosomal subunit protein bS21B Chelativorans sp. (strain BNC1)
Q7MSA5 8.38e-07 44 40 0 60 3 rpsU Small ribosomal subunit protein bS21 Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
B2IDB5 8.95e-07 45 43 2 65 3 rpsU Small ribosomal subunit protein bS21 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_17780
Feature type CDS
Gene rpsU
Product 30S ribosomal protein S21
Location 4411 - 4626 (strand: -1)
Length 216 (nucleotides) / 71 (amino acids)

Contig

Accession ZDB_538
Length 42795 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2280
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01165 Ribosomal protein S21

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0828 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein S21

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02970 small subunit ribosomal protein S21 Ribosome -

Protein Sequence

MPVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTVRKRAKASAVKRHAKKLARENARRTRLY

Flanking regions ( +/- flanking 50bp)

GACAACTGGCATAACGCCAGTACAGACCTATTTATTGAGGTGAGAGGCACATGCCGGTAATTAAAGTACGTGAAAACGAGCCATTTGACGTTGCACTGCGTCGTTTCAAACGTTCCTGCGAAAAAGCAGGCGTATTAGCTGAAGTACGTCGTCGTGAGTTTTATGAAAAACCAACGACTGTACGTAAACGCGCTAAAGCATCTGCTGTTAAGCGTCACGCTAAGAAACTGGCTCGCGAAAACGCACGTCGCACTCGTCTGTACTAATCGCTGCGGCCGCGCCGCAACTTAGTCAGACCGCAGTAGTTGCAGTTAAT