Homologs in group_2249

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_16925 FBDBKF_16925 100.0 Morganella morganii S1 tatA Sec-independent protein translocase subunit TatA
EHELCC_16665 EHELCC_16665 100.0 Morganella morganii S2 tatA Sec-independent protein translocase subunit TatA
LHKJJB_16595 LHKJJB_16595 100.0 Morganella morganii S3 tatA Sec-independent protein translocase subunit TatA
HKOGLL_17560 HKOGLL_17560 100.0 Morganella morganii S5 tatA Sec-independent protein translocase subunit TatA
F4V73_RS18395 F4V73_RS18395 91.9 Morganella psychrotolerans tatA Sec-independent protein translocase subunit TatA
PMI_RS17590 PMI_RS17590 71.4 Proteus mirabilis HI4320 tatA Sec-independent protein translocase subunit TatA

Distribution of the homologs in the orthogroup group_2249

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2249

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7MZ84 1.02e-34 116 72 2 87 3 tatA Sec-independent protein translocase protein TatA Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B4EWD2 2.6e-33 113 68 3 90 3 tatA Sec-independent protein translocase protein TatA Proteus mirabilis (strain HI4320)
P69431 1.56e-27 98 61 3 92 3 tatA Sec-independent protein translocase protein TatA Shigella flexneri
P69428 1.56e-27 98 61 3 92 1 tatA Sec-independent protein translocase protein TatA Escherichia coli (strain K12)
P69429 1.56e-27 98 61 3 92 3 tatA Sec-independent protein translocase protein TatA Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P69430 1.56e-27 98 61 3 92 3 tatA Sec-independent protein translocase protein TatA Escherichia coli O157:H7
P0A2H3 1.66e-26 95 60 3 87 3 tatA Sec-independent protein translocase protein TatA Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2H4 1.66e-26 95 60 3 87 3 tatA Sec-independent protein translocase protein TatA Salmonella typhi
B6EHA7 1.76e-26 95 60 2 85 3 tatA Sec-independent protein translocase protein TatA Aliivibrio salmonicida (strain LFI1238)
Q5E8V2 2.47e-26 95 57 1 85 3 tatA Sec-independent protein translocase protein TatA Aliivibrio fischeri (strain ATCC 700601 / ES114)
B5FF81 3.14e-26 95 57 1 85 3 tatA Sec-independent protein translocase protein TatA Aliivibrio fischeri (strain MJ11)
P57051 3.28e-26 94 58 2 85 3 tatA Sec-independent protein translocase protein TatA Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q87TH1 2.4e-25 92 56 1 85 3 tatA Sec-independent protein translocase protein TatA Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B7VHC4 2.52e-25 92 57 3 88 3 tatA Sec-independent protein translocase protein TatA Vibrio atlanticus (strain LGP32)
A7MZB7 6.25e-25 91 55 1 85 3 tatA Sec-independent protein translocase protein TatA Vibrio campbellii (strain ATCC BAA-1116)
Q8DDQ2 1.05e-24 90 58 2 85 3 tatA Sec-independent protein translocase protein TatA Vibrio vulnificus (strain CMCP6)
Q8ZAM2 3.34e-24 90 60 2 86 3 tatA Sec-independent protein translocase protein TatA Yersinia pestis
Q7MQ30 6.31e-24 89 58 2 85 3 tatA Sec-independent protein translocase protein TatA Vibrio vulnificus (strain YJ016)
A3QIE4 2.35e-22 85 55 2 86 3 tatA Sec-independent protein translocase protein TatA Shewanella loihica (strain ATCC BAA-1088 / PV-4)
B8CI03 2.63e-22 85 56 3 89 3 tatA Sec-independent protein translocase protein TatA Shewanella piezotolerans (strain WP3 / JCM 13877)
A8H969 7.1e-22 84 54 2 88 3 tatA Sec-independent protein translocase protein TatA Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B1KR04 3.29e-21 82 54 2 87 3 tatA Sec-independent protein translocase protein TatA Shewanella woodyi (strain ATCC 51908 / MS32)
A8G0T0 3.7e-21 82 50 2 89 3 tatA Sec-independent protein translocase protein TatA Shewanella sediminis (strain HAW-EB3)
Q9CKD3 3.83e-21 82 54 2 85 3 tatA Sec-independent protein translocase protein TatA Pasteurella multocida (strain Pm70)
B0BU11 5.81e-21 81 55 3 85 3 tatA Sec-independent protein translocase protein TatA Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GZD1 5.81e-21 81 55 3 85 3 tatA Sec-independent protein translocase protein TatA Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A3N3S3 5.81e-21 81 55 3 85 3 tatA Sec-independent protein translocase protein TatA Actinobacillus pleuropneumoniae serotype 5b (strain L20)
A6VM40 6.71e-21 81 59 1 74 3 tatA Sec-independent protein translocase protein TatA Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
A1RP81 8.55e-21 81 54 3 86 3 tatA Sec-independent protein translocase protein TatA Shewanella sp. (strain W3-18-1)
A4Y2Q2 8.55e-21 81 54 3 86 3 tatA Sec-independent protein translocase protein TatA Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A9KYL5 1.23e-20 80 53 3 86 3 tatA Sec-independent protein translocase protein TatA Shewanella baltica (strain OS195)
A6WIE6 1.23e-20 80 53 3 86 3 tatA Sec-independent protein translocase protein TatA Shewanella baltica (strain OS185)
A3D9F5 1.23e-20 80 53 3 86 3 tatA Sec-independent protein translocase protein TatA Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E6B3 1.23e-20 80 53 3 86 3 tatA Sec-independent protein translocase protein TatA Shewanella baltica (strain OS223)
Q2NWT8 1.28e-20 80 55 3 89 3 tatA Sec-independent protein translocase protein TatA Sodalis glossinidius (strain morsitans)
Q7VN63 2.42e-20 79 52 3 85 3 tatA Sec-independent protein translocase protein TatA Haemophilus ducreyi (strain 35000HP / ATCC 700724)
A0L1M7 2.9e-20 80 53 3 86 3 tatA Sec-independent protein translocase protein TatA Shewanella sp. (strain ANA-3)
Q088I1 3.54e-20 79 50 2 86 3 tatA Sec-independent protein translocase protein TatA Shewanella frigidimarina (strain NCIMB 400)
Q0HZQ0 4.03e-20 79 53 3 86 3 tatA Sec-independent protein translocase protein TatA Shewanella sp. (strain MR-7)
Q0HE98 4.03e-20 79 53 3 86 3 tatA Sec-independent protein translocase protein TatA Shewanella sp. (strain MR-4)
Q65VA3 6.09e-20 79 51 2 85 3 tatA Sec-independent protein translocase protein TatA Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
Q8E9R4 1.62e-19 78 51 3 88 3 tatA Sec-independent protein translocase protein TatA Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
D0ZCE7 2.97e-19 77 52 2 85 3 tatE Probable Sec-independent protein translocase protein TatE Edwardsiella tarda (strain EIB202)
Q1R003 3.26e-19 77 50 2 78 3 tatA Sec-independent protein translocase protein TatA Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
A1SRS1 6.02e-19 76 52 2 85 3 tatA Sec-independent protein translocase protein TatA Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
D4GM14 7.39e-19 75 66 0 54 3 tatE Probable Sec-independent protein translocase protein TatE Pantoea ananatis (strain LMG 20103)
A1SAK1 7.53e-19 76 71 0 49 3 tatA Sec-independent protein translocase protein TatA Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
C5BGE0 8.97e-19 75 63 1 61 3 tatE Probable Sec-independent protein translocase protein TatE Edwardsiella ictaluri (strain 93-146)
B0TJ19 1.22e-18 76 52 3 94 3 tatA Sec-independent protein translocase protein TatA Shewanella halifaxensis (strain HAW-EB4)
Q31E61 1.9e-18 75 51 4 88 3 tatA Sec-independent protein translocase protein TatA Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
A1U672 2.28e-18 74 47 2 80 3 tatA Sec-independent protein translocase protein TatA Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
E1SFR4 7.13e-18 73 64 0 54 3 tatE Probable Sec-independent protein translocase protein TatE Pantoea vagans (strain C9-1)
D2BUT3 2.09e-16 69 61 1 55 3 tatE Probable Sec-independent protein translocase protein TatE Dickeya zeae (strain Ech586)
C6CQJ7 2.09e-16 69 61 1 55 3 tatE Probable Sec-independent protein translocase protein TatE Dickeya chrysanthemi (strain Ech1591)
Q8ZDH1 2.1e-16 70 48 2 72 3 tatE Probable Sec-independent protein translocase protein TatE Yersinia pestis
D2TMS1 3.43e-16 68 60 1 61 3 tatE Probable Sec-independent protein translocase protein TatE Citrobacter rodentium (strain ICC168)
A7MNQ0 3.63e-16 68 57 1 64 3 tatE Probable Sec-independent protein translocase protein TatE Cronobacter sakazakii (strain ATCC BAA-894)
Q3IJV4 1.33e-15 68 42 2 89 3 tatA Sec-independent protein translocase protein TatA Pseudoalteromonas translucida (strain TAC 125)
Q6LVW7 1.68e-15 67 60 3 89 3 tatA Sec-independent protein translocase protein TatA Photobacterium profundum (strain SS9)
A6T688 2.03e-15 67 55 1 60 3 tatE Probable Sec-independent protein translocase protein TatE Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
P95557 2.89e-15 66 55 1 54 3 tatA Sec-independent protein translocase protein TatA Stutzerimonas stutzeri
B2VBK2 5.9e-15 65 51 0 60 3 tatE Probable Sec-independent protein translocase protein TatE Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
E3G4M1 8.84e-15 65 59 0 49 3 tatE Probable Sec-independent protein translocase protein TatE Enterobacter lignolyticus (strain SCF1)
A1VK47 1.42e-14 65 53 0 52 3 tatA Sec-independent protein translocase protein TatA Polaromonas naphthalenivorans (strain CJ2)
B0VL58 7.08e-14 63 47 0 48 3 tatA Sec-independent protein translocase protein TatA Acinetobacter baumannii (strain SDF)
B0V4S5 7.72e-14 63 47 0 48 3 tatA Sec-independent protein translocase protein TatA Acinetobacter baumannii (strain AYE)
A3M1X7 7.72e-14 63 47 0 48 3 tatA Sec-independent protein translocase protein TatA Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B2I3B1 7.72e-14 63 47 0 48 3 tatA Sec-independent protein translocase protein TatA Acinetobacter baumannii (strain ACICU)
B7I4W9 7.72e-14 63 47 0 48 3 tatA Sec-independent protein translocase protein TatA Acinetobacter baumannii (strain AB0057)
B7H0A3 7.72e-14 63 47 0 48 3 tatA Sec-independent protein translocase protein TatA Acinetobacter baumannii (strain AB307-0294)
A4SV24 1.28e-13 62 47 2 71 3 tatA Sec-independent protein translocase protein TatA Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
B4S170 2.54e-13 62 58 1 72 3 tatA Sec-independent protein translocase protein TatA Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
A9HWB1 3.15e-13 62 50 1 62 3 tatA Sec-independent protein translocase protein TatA Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q7VSY2 7.72e-13 60 46 1 62 3 tatA Sec-independent protein translocase protein TatA Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W2X5 7.72e-13 60 46 1 62 3 tatA Sec-independent protein translocase protein TatA Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WDX5 7.72e-13 60 46 1 62 3 tatA Sec-independent protein translocase protein TatA Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
B8F6M1 1.03e-12 60 53 3 86 3 tatA Sec-independent protein translocase protein TatA Glaesserella parasuis serovar 5 (strain SH0165)
Q12FC2 1.62e-12 60 49 0 53 3 tatA Sec-independent protein translocase protein TatA Polaromonas sp. (strain JS666 / ATCC BAA-500)
A9AE12 2.38e-12 59 53 0 47 3 tatA Sec-independent protein translocase protein TatA Burkholderia multivorans (strain ATCC 17616 / 249)
Q1LIB7 2.63e-12 59 44 0 59 3 tatA Sec-independent protein translocase protein TatA Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
B1XSV7 4.64e-12 58 40 1 71 3 tatA Sec-independent protein translocase protein TatA Polynucleobacter necessarius subsp. necessarius (strain STIR1)
B2UEE1 7.82e-12 58 50 1 50 3 tatA Sec-independent protein translocase protein TatA Ralstonia pickettii (strain 12J)
B2JHX4 9.45e-12 58 53 0 45 3 tatA Sec-independent protein translocase protein TatA Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q46WM3 1.14e-11 57 45 1 66 3 tatA Sec-independent protein translocase protein TatA Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q1BS36 1.14e-11 57 50 1 52 3 tatA Sec-independent protein translocase protein TatA Burkholderia orbicola (strain AU 1054)
B1JUB0 1.14e-11 57 50 1 52 3 tatA Sec-independent protein translocase protein TatA Burkholderia orbicola (strain MC0-3)
B4E646 1.14e-11 57 50 1 52 3 tatA Sec-independent protein translocase protein TatA Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A0K3W3 1.14e-11 57 50 1 52 3 tatA Sec-independent protein translocase protein TatA Burkholderia cenocepacia (strain HI2424)
A4JAX4 1.16e-11 57 50 1 52 3 tatA Sec-independent protein translocase protein TatA Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q0BIV9 1.16e-11 57 50 1 52 3 tatA Sec-independent protein translocase protein TatA Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YRW6 1.16e-11 57 50 1 52 3 tatA Sec-independent protein translocase protein TatA Burkholderia ambifaria (strain MC40-6)
Q63Q97 1.47e-11 57 49 1 53 3 tatA Sec-independent protein translocase protein TatA Burkholderia pseudomallei (strain K96243)
A3NE88 1.47e-11 57 49 1 53 3 tatA Sec-independent protein translocase protein TatA Burkholderia pseudomallei (strain 668)
Q3JN07 1.47e-11 57 49 1 53 3 tatA Sec-independent protein translocase protein TatA Burkholderia pseudomallei (strain 1710b)
A3P022 1.47e-11 57 49 1 53 3 tatA Sec-independent protein translocase protein TatA Burkholderia pseudomallei (strain 1106a)
A1V8I0 1.47e-11 57 49 1 53 3 tatA Sec-independent protein translocase protein TatA Burkholderia mallei (strain SAVP1)
Q62GF0 1.47e-11 57 49 1 53 3 tatA Sec-independent protein translocase protein TatA Burkholderia mallei (strain ATCC 23344)
A2S759 1.47e-11 57 49 1 53 3 tatA Sec-independent protein translocase protein TatA Burkholderia mallei (strain NCTC 10229)
A3MPT9 1.47e-11 57 49 1 53 3 tatA Sec-independent protein translocase protein TatA Burkholderia mallei (strain NCTC 10247)
Q8XV89 1.54e-11 57 48 1 50 3 tatA Sec-independent protein translocase protein TatA Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B2SZ54 1.58e-11 57 45 0 53 3 tatA Sec-independent protein translocase protein TatA Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
Q12S26 1.67e-11 57 47 1 86 3 tatA Sec-independent protein translocase protein TatA Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q2SUB3 1.76e-11 57 53 0 43 3 tatA Sec-independent protein translocase protein TatA Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q39K80 1.87e-11 57 53 0 43 3 tatA Sec-independent protein translocase protein TatA Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A1TL12 2.05e-11 57 44 1 63 3 tatA Sec-independent protein translocase protein TatA Paracidovorax citrulli (strain AAC00-1)
C5CQK5 2.11e-11 57 51 0 45 3 tatA Sec-independent protein translocase protein TatA Variovorax paradoxus (strain S110)
Q2KTS7 2.37e-11 57 50 0 50 3 tatA Sec-independent protein translocase protein TatA Bordetella avium (strain 197N)
Q0K698 3.09e-11 57 47 2 65 3 tatA Sec-independent protein translocase protein TatA Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
B0UI86 3.46e-11 57 44 0 56 3 tatA Sec-independent protein translocase protein TatA Methylobacterium sp. (strain 4-46)
B3R789 3.52e-11 56 53 0 45 3 tatA Sec-independent protein translocase protein TatA Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q47AM7 4.14e-11 56 47 0 51 3 tatA Sec-independent protein translocase protein TatA Dechloromonas aromatica (strain RCB)
A5EVU2 4.32e-11 56 57 0 45 3 tatA Sec-independent protein translocase protein TatA Dichelobacter nodosus (strain VCS1703A)
A1W450 4.43e-11 56 34 0 82 3 tatA Sec-independent protein translocase protein TatA Acidovorax sp. (strain JS42)
B9MDW9 4.89e-11 56 44 0 56 3 tatA Sec-independent protein translocase protein TatA Acidovorax ebreus (strain TPSY)
A9BXA7 5.02e-11 56 53 0 45 3 tatA Sec-independent protein translocase protein TatA Delftia acidovorans (strain DSM 14801 / SPH-1)
Q13TR5 6.81e-11 55 51 0 43 3 tatA Sec-independent protein translocase protein TatA Paraburkholderia xenovorans (strain LB400)
Q3J6P7 7.59e-11 56 43 1 83 3 tatA Sec-independent protein translocase protein TatA Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
B8I9T7 9.54e-11 55 44 0 54 3 tatA Sec-independent protein translocase protein TatA Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
A6T372 1.33e-10 55 42 1 63 3 tatA Sec-independent protein translocase protein TatA Janthinobacterium sp. (strain Marseille)
A1KAV0 1.42e-10 55 57 0 40 3 tatA Sec-independent protein translocase protein TatA Azoarcus sp. (strain BH72)
A4G9I2 2.53e-10 54 42 1 63 3 tatA Sec-independent protein translocase protein TatA Herminiimonas arsenicoxydans
Q2IQM4 6.04e-10 53 50 0 48 3 tatA Sec-independent protein translocase protein TatA Anaeromyxobacter dehalogenans (strain 2CP-C)
Q7NMQ4 3.2e-09 51 34 1 69 3 tatA Sec-independent protein translocase protein TatA Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
B1ZLT9 3.91e-09 52 38 0 55 3 tatA Sec-independent protein translocase protein TatA Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A9W7L6 3.92e-09 52 32 2 82 3 tatA Sec-independent protein translocase protein TatA Methylorubrum extorquens (strain PA1)
B7KX02 4.27e-09 52 32 2 82 3 tatA Sec-independent protein translocase protein TatA Methylorubrum extorquens (strain CM4 / NCIMB 13688)
A6VT98 6.93e-09 50 57 1 56 3 tatA Sec-independent protein translocase protein TatA Marinomonas sp. (strain MWYL1)
P0A846 1.02e-08 50 51 1 70 3 tatE Probable Sec-independent protein translocase protein TatE Shigella flexneri
P0A843 1.02e-08 50 51 1 70 2 tatE Sec-independent protein translocase protein TatE Escherichia coli (strain K12)
P0A844 1.02e-08 50 51 1 70 3 tatE Probable Sec-independent protein translocase protein TatE Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0A845 1.02e-08 50 51 1 70 3 tatE Probable Sec-independent protein translocase protein TatE Escherichia coli O157:H7
B7LLI4 1.15e-08 50 70 0 47 3 tatE Probable Sec-independent protein translocase protein TatE Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
Q2ND30 1.78e-08 49 41 0 48 3 tatA Sec-independent protein translocase protein TatA Erythrobacter litoralis (strain HTCC2594)
Q0VMA0 1.86e-08 49 49 1 73 3 tatA Sec-independent protein translocase protein TatA Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
D5CHK9 2.13e-08 49 68 0 47 3 tatE Probable Sec-independent protein translocase protein TatE Enterobacter cloacae subsp. cloacae (strain ATCC 13047 / DSM 30054 / NBRC 13535 / NCTC 10005 / WDCM 00083 / NCDC 279-56)
Q9HUB5 2.29e-08 49 38 0 63 3 tatA Sec-independent protein translocase protein TatA Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02EU9 2.29e-08 49 38 0 63 3 tatA Sec-independent protein translocase protein TatA Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V3G1 2.29e-08 49 38 0 63 3 tatA Sec-independent protein translocase protein TatA Pseudomonas aeruginosa (strain LESB58)
A1WFS6 3.71e-08 48 37 2 79 3 tatA Sec-independent protein translocase protein TatA Verminephrobacter eiseniae (strain EF01-2)
A8AJH7 4.62e-08 48 68 0 47 3 tatE Probable Sec-independent protein translocase protein TatE Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P0A2H5 5.27e-08 48 68 0 47 3 tatE Probable Sec-independent protein translocase protein TatE Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2H6 5.27e-08 48 68 0 47 3 tatE Probable Sec-independent protein translocase protein TatE Salmonella typhi
B5FMM7 5.27e-08 48 68 0 47 3 tatE Probable Sec-independent protein translocase protein TatE Salmonella dublin (strain CT_02021853)
Q7MSR8 6.48e-08 48 37 1 77 3 tatA Sec-independent protein translocase protein TatA Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
A9MKE5 7.7e-08 47 68 0 47 3 tatE Probable Sec-independent protein translocase protein TatE Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q98LC5 8.55e-08 48 35 1 64 3 tatA Sec-independent protein translocase protein TatA Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
A6VDJ1 9.19e-08 48 36 0 63 3 tatA Sec-independent protein translocase protein TatA Pseudomonas aeruginosa (strain PA7)
Q2YAV4 9.43e-08 47 43 1 74 3 tatA Sec-independent protein translocase protein TatA Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A9B6A7 9.94e-08 47 42 0 47 3 tatA Sec-independent protein translocase protein TatA Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
Q4JVQ1 1.04e-07 48 36 2 77 3 tatA Sec-independent protein translocase protein TatA Corynebacterium jeikeium (strain K411)
Q4FQ61 1.37e-07 47 41 1 75 3 tatA Sec-independent protein translocase protein TatA Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q73YX3 1.56e-07 47 29 1 79 3 tatA Sec-independent protein translocase protein TatA Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
A0QFC0 1.56e-07 47 29 1 79 3 tatA Sec-independent protein translocase protein TatA Mycobacterium avium (strain 104)
Q2SN17 1.9e-07 47 62 0 43 3 tatA Sec-independent protein translocase protein TatA Hahella chejuensis (strain KCTC 2396)
C1DAK9 2.06e-07 47 46 0 56 3 tatA Sec-independent protein translocase protein TatA Laribacter hongkongensis (strain HLHK9)
B2V6F7 2.11e-07 47 38 0 63 3 tatA Sec-independent protein translocase protein TatA Sulfurihydrogenibium sp. (strain YO3AOP1)
A1TAN7 2.16e-07 47 32 2 84 3 tatA Sec-independent protein translocase protein TatA Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
Q2G9D4 2.87e-07 47 32 0 56 3 tatA Sec-independent protein translocase protein TatA Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q3SI71 2.88e-07 46 42 0 66 3 tatA Sec-independent protein translocase protein TatA Thiobacillus denitrificans (strain ATCC 25259)
Q0AET7 3.71e-07 46 52 1 50 3 tatA Sec-independent protein translocase protein TatA Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
A2SE14 6.51e-07 45 48 1 64 3 tatA Sec-independent protein translocase protein TatA Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
Q4FM05 7.79e-07 45 32 1 74 3 tatA Sec-independent protein translocase protein TatA Pelagibacter ubique (strain HTCC1062)
B1M332 8.52e-07 45 42 0 47 3 tatA Sec-independent protein translocase protein TatA Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
C1D186 1.08e-06 45 37 0 54 3 tatA Sec-independent protein translocase protein TatA Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
A1WW03 1.17e-06 45 49 0 59 3 tatA Sec-independent protein translocase protein TatA Halorhodospira halophila (strain DSM 244 / SL1)
P72267 1.4e-06 45 30 1 79 3 tatA Sec-independent protein translocase protein TatA Rhodococcus erythropolis
A5UAW7 1.62e-06 44 52 0 50 3 tatA Sec-independent protein translocase protein TatA Haemophilus influenzae (strain PittEE)
A3PB74 1.67e-06 45 32 1 75 3 tatA Sec-independent protein translocase protein TatA Prochlorococcus marinus (strain MIT 9301)
Q82WM9 1.94e-06 44 50 1 50 3 tatA Sec-independent protein translocase protein TatA Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A4YV73 2.19e-06 44 35 0 53 3 tatA Sec-independent protein translocase protein TatA Bradyrhizobium sp. (strain ORS 278)
A5EJW2 2.19e-06 44 35 0 53 3 tatA Sec-independent protein translocase protein TatA Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q1B952 2.58e-06 44 31 3 86 3 tatA Sec-independent protein translocase protein TatA Mycobacterium sp. (strain MCS)
A1UFV8 2.58e-06 44 31 3 86 3 tatA Sec-independent protein translocase protein TatA Mycobacterium sp. (strain KMS)
A3PZG8 2.58e-06 44 31 3 86 3 tatA Sec-independent protein translocase protein TatA Mycobacterium sp. (strain JLS)
Q89KZ7 2.6e-06 44 37 0 48 3 tatA Sec-independent protein translocase protein TatA Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q3KJD0 3.72e-06 44 60 1 35 3 tatA Sec-independent protein translocase protein TatA Pseudomonas fluorescens (strain Pf0-1)
Q214X2 4.01e-06 43 29 1 77 3 tatA Sec-independent protein translocase protein TatA Rhodopseudomonas palustris (strain BisB18)
B3Q6I3 4.52e-06 43 29 1 77 3 tatA Sec-independent protein translocase protein TatA Rhodopseudomonas palustris (strain TIE-1)
Q6N5X1 4.52e-06 43 29 1 77 3 tatA Sec-independent protein translocase protein TatA Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
P57046 5.94e-06 43 52 0 50 3 tatA Sec-independent protein translocase protein TatA Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P9WGA1 6.37e-06 43 34 1 55 1 tatA Sec-independent protein translocase protein TatA Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGA0 6.37e-06 43 34 1 55 3 tatA Sec-independent protein translocase protein TatA Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U4C0 6.37e-06 43 34 1 55 3 tatA Sec-independent protein translocase protein TatA Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
C1AQ13 6.37e-06 43 34 1 55 3 tatA Sec-independent protein translocase protein TatA Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KKE0 6.37e-06 43 34 1 55 3 tatA Sec-independent protein translocase protein TatA Mycobacterium bovis (strain BCG / Pasteur 1173P2)
P66890 6.37e-06 43 34 1 55 3 tatA Sec-independent protein translocase protein TatA Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q4ZZG8 6.6e-06 43 65 0 29 3 tatA Sec-independent protein translocase protein TatA Pseudomonas syringae pv. syringae (strain B728a)
Q48PJ9 6.6e-06 43 65 0 29 3 tatA Sec-independent protein translocase protein TatA Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q5P799 7.05e-06 43 50 0 52 3 tatA Sec-independent protein translocase protein TatA Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q6ML26 7.11e-06 43 29 2 84 3 tatA Sec-independent protein translocase protein TatA Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q136H1 8.1e-06 43 34 0 49 3 tatA Sec-independent protein translocase protein TatA Rhodopseudomonas palustris (strain BisB5)
C3K8T9 8.9e-06 43 58 1 34 3 tatA Sec-independent protein translocase protein TatA Pseudomonas fluorescens (strain SBW25)
Q0A5D5 9.12e-06 43 58 0 41 3 tatA Sec-independent protein translocase protein TatA Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q2IWG3 1.01e-05 42 34 0 49 3 tatA Sec-independent protein translocase protein TatA Rhodopseudomonas palustris (strain HaA2)
Q0SIG6 1.2e-05 42 31 1 64 3 tatA Sec-independent protein translocase protein TatA Rhodococcus jostii (strain RHA1)
Q3SRQ1 1.26e-05 42 32 0 49 3 tatA Sec-independent protein translocase protein TatA Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
C1ARZ5 1.4e-05 42 32 1 64 3 tatA Sec-independent protein translocase protein TatA Rhodococcus opacus (strain B4)
Q1QME5 1.45e-05 42 32 0 49 3 tatA Sec-independent protein translocase protein TatA Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A4QI94 1.47e-05 42 36 0 47 3 tatA Sec-independent protein translocase protein TatA Corynebacterium glutamicum (strain R)
A2BPF4 1.57e-05 42 35 1 59 3 tatA Sec-independent protein translocase protein TatA Prochlorococcus marinus (strain AS9601)
Q87UY7 1.83e-05 42 62 0 29 3 tatA Sec-independent protein translocase protein TatA Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q5WSQ5 2.2e-05 41 60 0 30 3 tatA Sec-independent protein translocase protein TatA Legionella pneumophila (strain Lens)
Q5X0X3 2.2e-05 41 60 0 30 3 tatA Sec-independent protein translocase protein TatA Legionella pneumophila (strain Paris)
A5II94 2.27e-05 41 60 0 30 3 tatA Sec-independent protein translocase protein TatA Legionella pneumophila (strain Corby)
B0UVD4 2.39e-05 41 43 3 67 3 tatA Sec-independent protein translocase protein TatA Histophilus somni (strain 2336)
Q0I207 2.39e-05 41 43 3 67 3 tatA Sec-independent protein translocase protein TatA Histophilus somni (strain 129Pt)
Q30PL2 3.02e-05 41 41 2 70 3 tatA Sec-independent protein translocase protein TatA Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251)
Q4KJL7 3.02e-05 42 58 0 29 3 tatA Sec-independent protein translocase protein TatA Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
C1DHS7 3.49e-05 41 60 0 28 3 tatA Sec-independent protein translocase protein TatA Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
C3MBT9 4.39e-05 40 38 0 67 3 tatA Sec-independent protein translocase protein TatA Sinorhizobium fredii (strain NBRC 101917 / NGR234)
A6QCE0 4.93e-05 40 48 0 43 3 tatA Sec-independent protein translocase protein TatA Sulfurovum sp. (strain NBC37-1)
A4TB40 5.49e-05 41 38 1 55 3 tatA Sec-independent protein translocase protein TatA Mycolicibacterium gilvum (strain PYR-GCK)
A0RQU1 5.62e-05 40 35 1 71 3 tatA Sec-independent protein translocase protein TatA Campylobacter fetus subsp. fetus (strain 82-40)
B2IJG4 6.28e-05 40 25 1 71 3 tatA Sec-independent protein translocase protein TatA Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
B8ELH2 7.61e-05 40 32 2 61 3 tatA Sec-independent protein translocase protein TatA Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
A0QZ40 8.39e-05 40 32 1 67 3 tatA Sec-independent protein translocase protein TatA Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
A8G311 8.78e-05 40 35 1 57 3 tatA Sec-independent protein translocase protein TatA Prochlorococcus marinus (strain MIT 9215)
B2SIH3 9.01e-05 40 47 0 48 3 tatA Sec-independent protein translocase protein TatA Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2NXS0 9.01e-05 40 47 0 48 3 tatA Sec-independent protein translocase protein TatA Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q3BMG1 9.01e-05 40 47 0 48 3 tatA Sec-independent protein translocase protein TatA Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PEX2 9.01e-05 40 47 0 48 3 tatA Sec-independent protein translocase protein TatA Xanthomonas axonopodis pv. citri (strain 306)
A0PQS8 0.000101 40 32 1 55 3 tatA Sec-independent protein translocase protein TatA Mycobacterium ulcerans (strain Agy99)
B2HFV1 0.000101 40 32 1 55 3 tatA Sec-independent protein translocase protein TatA Mycobacterium marinum (strain ATCC BAA-535 / M)
A7ZF22 0.000111 40 33 0 65 3 tatA Sec-independent protein translocase protein TatA Campylobacter concisus (strain 13826)
B4SNR8 0.000112 40 43 0 51 3 tatA Sec-independent protein translocase protein TatA Stenotrophomonas maltophilia (strain R551-3)
Q5N2J3 0.000117 40 40 0 40 3 tatA Sec-independent protein translocase protein TatA Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31RR1 0.000117 40 40 0 40 3 tatA Sec-independent protein translocase protein TatA Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
B2FP54 0.000146 39 43 0 51 3 tatA Sec-independent protein translocase protein TatA Stenotrophomonas maltophilia (strain K279a)
Q5NN66 0.000153 40 31 0 47 3 tatA Sec-independent protein translocase protein TatA Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q1IP20 0.000192 38 38 0 47 3 tatA Sec-independent protein translocase protein TatA Koribacter versatilis (strain Ellin345)
Q5WJP2 0.000225 38 32 1 56 3 tatA Sec-independent protein translocase protein TatA Shouchella clausii (strain KSM-K16)
Q5HBS1 0.000239 38 41 1 48 3 tatA Sec-independent protein translocase protein TatA Ehrlichia ruminantium (strain Welgevonden)
A6U8N5 0.00025 38 38 0 67 3 tatA Sec-independent protein translocase protein TatA Sinorhizobium medicae (strain WSM419)
A8F2N4 0.000393 38 38 1 52 3 tatA Sec-independent protein translocase protein TatA Rickettsia massiliae (strain Mtu5)
Q4UK88 0.000415 38 40 0 44 3 tatA Sec-independent protein translocase protein TatA Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q9ZCJ1 0.000452 38 40 1 52 3 tatA Sec-independent protein translocase protein TatA Rickettsia prowazekii (strain Madrid E)
Q92Q25 0.000462 38 37 0 67 3 tatA Sec-independent protein translocase protein TatA Rhizobium meliloti (strain 1021)
Q5GRV8 0.000515 37 35 0 42 3 tatA Sec-independent protein translocase protein TatA Wolbachia sp. subsp. Brugia malayi (strain TRS)
B3CMZ0 0.000515 37 35 0 42 3 tatA Sec-independent protein translocase protein TatA Wolbachia pipientis subsp. Culex pipiens (strain wPip)
Q73IK8 0.000515 37 35 0 42 3 tatA Sec-independent protein translocase protein TatA Wolbachia pipientis wMel
Q92GG3 0.000562 37 38 1 52 3 tatA Sec-independent protein translocase protein TatA Rickettsia conorii (strain ATCC VR-613 / Malish 7)
A8GPQ1 0.000713 37 38 1 52 3 tatA Sec-independent protein translocase protein TatA Rickettsia akari (strain Hartford)
Q7P0E4 0.000735 37 43 1 60 3 tatA Sec-independent protein translocase protein TatA Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q8P3H8 0.000736 37 45 0 48 3 tatA Sec-independent protein translocase protein TatA Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RYY1 0.000736 37 45 0 48 3 tatA Sec-independent protein translocase protein TatA Xanthomonas campestris pv. campestris (strain B100)
Q4UP01 0.000736 37 45 0 48 3 tatA Sec-independent protein translocase protein TatA Xanthomonas campestris pv. campestris (strain 8004)
C3PLM6 0.000821 37 38 1 52 3 tatA Sec-independent protein translocase protein TatA Rickettsia africae (strain ESF-5)
Q68W01 0.000876 37 38 0 44 3 tatA Sec-independent protein translocase protein TatA Rickettsia typhi (strain ATCC VR-144 / Wilmington)
A8GTK4 0.000885 37 38 1 52 3 tatA Sec-independent protein translocase protein TatA Rickettsia rickettsii (strain Sheila Smith)
B0BV41 0.000885 37 38 1 52 3 tatA Sec-independent protein translocase protein TatA Rickettsia rickettsii (strain Iowa)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_16875
Feature type CDS
Gene tatA
Product Sec-independent protein translocase subunit TatA
Location 55267 - 55527 (strand: 1)
Length 261 (nucleotides) / 86 (amino acids)
In genomic island -

Contig

Accession ZDB_534
Length 68509 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2249
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02416 mttA/Hcf106 family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1826 Intracellular trafficking, secretion, and vesicular transport (U) U Twin-arginine protein secretion pathway components TatA and TatB

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03116 sec-independent protein translocase protein TatA Protein export
Bacterial secretion system
-

Protein Sequence

MAGINIWQLLIIAVIVVLLFGTNKLRTLGSDLGASIKGFKKAIGDEDQNKADTTTAGKDADFEQKNIAEKKADTAEQPENKNKEQV

Flanking regions ( +/- flanking 50bp)

GGTTGTATATAATGAAGTAAGTAGGTCCATATCAATTTGAGGTAAAACTAATGGCCGGTATTAATATTTGGCAATTGTTAATTATTGCTGTGATTGTTGTACTCCTGTTCGGAACAAACAAACTCCGTACCCTGGGATCTGATTTAGGCGCATCTATCAAAGGCTTTAAAAAAGCTATCGGTGATGAAGATCAAAACAAAGCAGATACAACAACAGCCGGAAAAGACGCGGATTTTGAACAAAAAAATATCGCAGAAAAGAAAGCTGATACAGCTGAGCAGCCAGAGAATAAAAACAAAGAGCAGGTATAACCCGTGTTTGACATCGGTTTTGGTGAACTGATCTTAGTATTGGTTATCGG