Homologs in group_443

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_17025 FBDBKF_17025 100.0 Morganella morganii S1 ssb Single-stranded DNA-binding protein
EHELCC_16565 EHELCC_16565 100.0 Morganella morganii S2 ssb Single-stranded DNA-binding protein
LHKJJB_16695 LHKJJB_16695 100.0 Morganella morganii S3 ssb Single-stranded DNA-binding protein
HKOGLL_17660 HKOGLL_17660 100.0 Morganella morganii S5 ssb Single-stranded DNA-binding protein
F4V73_RS18505 F4V73_RS18505 95.3 Morganella psychrotolerans - single-stranded DNA-binding protein
PMI_RS13540 PMI_RS13540 90.1 Proteus mirabilis HI4320 ssb1 single-stranded DNA-binding protein SSB1

Distribution of the homologs in the orthogroup group_443

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_443

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P25762 1.28e-86 254 81 3 177 1 ssb Single-stranded DNA-binding protein Serratia marcescens
P0AGE3 2.53e-86 254 78 2 179 3 ssb Single-stranded DNA-binding protein Shigella flexneri
P0AGE0 2.53e-86 254 78 2 179 1 ssb Single-stranded DNA-binding protein Escherichia coli (strain K12)
P0AGE1 2.53e-86 254 78 2 179 3 ssb Single-stranded DNA-binding protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AGE2 2.53e-86 254 78 2 179 3 ssb Single-stranded DNA-binding protein Escherichia coli O157:H7
P28046 5.18e-84 248 82 3 175 1 ssb Single-stranded DNA-binding protein Proteus mirabilis
Q9KUW2 3.23e-82 243 69 4 185 3 ssb Single-stranded DNA-binding protein Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q9XJG4 6.56e-80 237 66 2 172 3 ssb Single-stranded DNA-binding protein Escherichia phage P1
Q8ZJ06 6.04e-78 233 78 2 182 3 ssb Single-stranded DNA-binding protein Yersinia pestis
P0A2F6 1.26e-77 231 76 4 178 1 ssb Single-stranded DNA-binding protein 1 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2F7 1.26e-77 231 76 4 178 3 ssb Single-stranded DNA-binding protein 1 Salmonella typhi
Q8K933 1.07e-76 229 63 2 172 3 ssb Single-stranded DNA-binding protein Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
P57610 1.67e-74 223 63 2 174 3 ssb Single-stranded DNA-binding protein Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
Q9RHF4 4.29e-74 223 67 4 174 3 ssb2 Single-stranded DNA-binding protein 2 Salmonella typhi
Q8L2A6 1.1e-73 222 68 4 185 3 ssb Single-stranded DNA-binding protein Proteus vulgaris
Q8D254 1.02e-72 219 60 2 174 3 ssb Single-stranded DNA-binding protein Wigglesworthia glossinidia brevipalpis
Q89A53 6.48e-71 214 60 3 173 3 ssb Single-stranded DNA-binding protein Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q87LA3 1.31e-70 214 67 2 176 3 ssb Single-stranded DNA-binding protein Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q8DCJ0 4.4e-68 207 63 3 186 3 ssb Single-stranded DNA-binding protein Vibrio vulnificus (strain CMCP6)
P28044 2.08e-67 206 59 3 176 1 ssb Plasmid-derived single-stranded DNA-binding protein Escherichia coli
Q93GP7 9.13e-67 204 59 0 172 3 ssb2 Single-stranded DNA-binding protein 2 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P40947 3.35e-65 199 64 1 170 1 ssb Single-stranded DNA-binding protein Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q8EA81 2.23e-64 200 75 1 127 3 ssb Single-stranded DNA-binding protein Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
P28045 7.84e-62 191 56 4 183 3 ssb Plasmid-derived single-stranded DNA-binding protein Escherichia coli
P28043 8.53e-62 191 53 5 192 3 ssb Plasmid-derived single-stranded DNA-binding protein Escherichia coli
P18022 2.31e-61 190 56 4 183 3 ssb Plasmid-derived single-stranded DNA-binding protein Escherichia coli
Q83EP4 3.43e-61 189 57 3 170 1 ssb Single-stranded DNA-binding protein Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
P59930 8.58e-61 189 56 6 178 3 ssb Single-stranded DNA-binding protein Haemophilus ducreyi (strain 35000HP / ATCC 700724)
P59927 9.89e-61 189 56 5 178 3 ssb Single-stranded DNA-binding protein Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
P18310 7.87e-60 186 62 3 149 3 ssbF Plasmid-derived single-stranded DNA-binding protein Escherichia coli (strain K12)
P44409 4.97e-56 176 56 5 174 3 ssb Single-stranded DNA-binding protein Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
Q9CJP4 8.15e-56 176 56 8 174 3 ssb Single-stranded DNA-binding protein Pasteurella multocida (strain Pm70)
Q8VMM4 8.74e-56 176 66 2 129 3 ssb Single-stranded DNA-binding protein Pseudomonas putida
Q889U1 1.36e-55 176 71 1 114 3 ssb Single-stranded DNA-binding protein Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q847G1 7.37e-55 173 72 1 114 3 ssb Single-stranded DNA-binding protein Pseudomonas putida
Q82S98 3.89e-54 171 54 5 172 3 ssb Single-stranded DNA-binding protein Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q88QK5 1.09e-52 169 69 1 111 3 ssb Single-stranded DNA-binding protein Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
P77953 1.26e-50 165 68 3 117 3 ssb Single-stranded DNA-binding protein Shewanella hanedai
Q8YHC2 3.06e-50 162 50 3 169 3 ssb Single-stranded DNA-binding protein Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q8G0J1 1.21e-47 155 62 2 115 3 ssb Single-stranded DNA-binding protein Brucella suis biovar 1 (strain 1330)
Q8Y2B4 3.11e-47 154 63 3 116 3 ssb Single-stranded DNA-binding protein Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
P59928 4.19e-47 154 63 3 114 3 ssb Single-stranded DNA-binding protein Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
P66846 4.73e-47 154 63 3 114 3 ssb Single-stranded DNA-binding protein Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
P66847 4.73e-47 154 63 3 114 3 ssb Single-stranded DNA-binding protein Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
P66849 6.81e-47 154 47 4 176 3 ssb Single-stranded DNA-binding protein Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P66848 6.81e-47 154 47 4 176 3 ssb Single-stranded DNA-binding protein Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
P0C118 9.37e-47 153 61 2 115 3 ssb Single-stranded DNA-binding protein Brucella abortus biovar 1 (strain 9-941)
Q2YPX7 9.37e-47 153 61 2 115 3 ssb Single-stranded DNA-binding protein Brucella abortus (strain 2308)
Q98M41 2.64e-46 152 64 2 115 3 ssb Single-stranded DNA-binding protein Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q9A894 1.06e-45 150 61 2 115 3 ssb Single-stranded DNA-binding protein Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q9ZAQ8 4.29e-45 149 52 2 170 3 ssb Single-stranded DNA-binding protein Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q89L50 4.53e-45 149 51 3 169 3 ssb Single-stranded DNA-binding protein Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q68Y11 1.1e-44 147 44 5 171 3 ssb Single-stranded DNA-binding protein Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Q4UJW3 2.26e-44 146 44 4 170 3 ssb Single-stranded DNA-binding protein Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
Q92G30 1.03e-43 145 43 5 171 3 ssb Single-stranded DNA-binding protein Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q9ZCC2 1.83e-43 144 44 4 170 3 ssb Single-stranded DNA-binding protein Rickettsia prowazekii (strain Madrid E)
Q9PHE7 9.64e-43 142 56 2 116 3 ssb1 Single-stranded DNA-binding protein 1 Xylella fastidiosa (strain 9a5c)
Q1RK72 7.09e-42 140 42 4 170 3 ssb Single-stranded DNA-binding protein Rickettsia bellii (strain RML369-C)
Q8KB47 1.31e-41 140 45 5 172 3 ssb1 Single-stranded DNA-binding protein 1 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
P56898 6.8e-41 138 46 5 176 3 ssb Single-stranded DNA-binding protein Rhizobium meliloti (strain 1021)
Q8UF87 8.14e-40 135 54 2 111 3 ssb Single-stranded DNA-binding protein Agrobacterium fabrum (strain C58 / ATCC 33970)
Q9PDI7 6.33e-39 133 52 5 173 3 ssb2 Single-stranded DNA-binding protein 2 Xylella fastidiosa (strain 9a5c)
Q87DQ5 1.4e-38 132 57 2 111 3 ssb Single-stranded DNA-binding protein Xylella fastidiosa (strain Temecula1 / ATCC 700964)
Q8P778 8.82e-38 130 55 2 111 3 ssb Single-stranded DNA-binding protein Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q8PIJ2 1.05e-37 130 56 2 111 3 ssb Single-stranded DNA-binding protein Xanthomonas axonopodis pv. citri (strain 306)
Q8A7M7 1.9e-29 108 46 3 119 3 ssb Single-stranded DNA-binding protein Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
P59933 9.58e-29 107 40 6 171 3 ssb Single-stranded DNA-binding protein Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W)
P59931 1.87e-26 101 37 5 176 3 ssb Single-stranded DNA-binding protein Helicobacter hepaticus (strain ATCC 51449 / 3B1)
Q9K5N9 1.94e-24 96 36 6 171 3 ssb Single-stranded DNA-binding protein Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
Q814G6 1.65e-23 94 37 6 175 3 ssb Single-stranded DNA-binding protein Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
Q81JI3 5.24e-23 92 37 8 180 3 ssb Single-stranded DNA-binding protein Bacillus anthracis
Q9WZ73 4.21e-22 89 42 1 104 1 ssb Single-stranded DNA-binding protein Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q8CX55 1.96e-20 85 34 4 168 3 ssb Single-stranded DNA-binding protein Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
Q92FK7 2.1e-20 85 32 6 169 3 ssb2 Single-stranded DNA-binding protein 2 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
P59932 2.39e-20 85 40 4 113 3 ssb Single-stranded DNA-binding protein Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q8R6M2 4.8e-20 84 34 5 167 3 ssb Single-stranded DNA-binding protein Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
Q9ZJY2 1.72e-19 84 31 6 184 3 ssb Single-stranded DNA-binding protein Helicobacter pylori (strain J99 / ATCC 700824)
O25841 2.46e-19 83 38 2 112 1 ssb Single-stranded DNA-binding protein Helicobacter pylori (strain ATCC 700392 / 26695)
Q9CDM9 2.71e-19 82 33 10 181 3 ssb2 Single-stranded DNA-binding protein 2 Lactococcus lactis subsp. lactis (strain IL1403)
O69302 3.06e-19 83 38 2 113 3 ssb Single-stranded DNA-binding protein Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
Q8NZJ0 4.31e-19 82 34 7 175 3 ssb2 Single-stranded DNA-binding protein 2 Streptococcus pyogenes serotype M18 (strain MGAS8232)
P66855 5.84e-19 81 33 6 168 3 ssb Single-stranded DNA-binding protein Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
P66854 5.84e-19 81 33 6 168 1 ssb Single-stranded DNA-binding protein Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
P0DF77 6.46e-19 82 33 7 175 3 ssb Single-stranded DNA-binding protein Streptococcus pyogenes serotype M3 (strain SSI-1)
P0DF76 6.46e-19 82 33 7 175 3 ssb Single-stranded DNA-binding protein Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
P66852 6.46e-19 82 33 7 175 3 ssb3 Single-stranded DNA-binding protein Streptococcus pyogenes serotype M1
Q5XA62 6.46e-19 82 33 7 175 3 ssb2 Single-stranded DNA-binding protein 2 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P66851 6.75e-19 82 32 4 168 3 ssb1 Single-stranded DNA-binding protein 1 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
P66850 6.75e-19 82 32 4 168 3 ssb1 Single-stranded DNA-binding protein 1 Streptococcus agalactiae serotype III (strain NEM316)
P37455 7.07e-19 82 41 2 97 1 ssbA Single-stranded DNA-binding protein A Bacillus subtilis (strain 168)
Q55499 1e-18 80 40 3 112 3 ssb Single-stranded DNA-binding protein 1 Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
Q8Y4X1 1.23e-18 81 30 5 168 3 ssb2 Single-stranded DNA-binding protein 2 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q9CGS5 1.92e-18 80 33 6 167 3 ssb1 Single-stranded DNA-binding protein 1 Lactococcus lactis subsp. lactis (strain IL1403)
Q5RDQ0 4.74e-18 79 35 2 111 2 SSBP1 Single-stranded DNA-binding protein, mitochondrial Pongo abelii
Q931K4 5.04e-18 79 34 6 167 3 ssb Single-stranded DNA-binding protein 1 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q839Y9 6.09e-18 80 33 3 139 3 ssb Single-stranded DNA-binding protein Enterococcus faecalis (strain ATCC 700802 / V583)
Q6GF73 6.24e-18 79 34 6 167 3 ssb Single-stranded DNA-binding protein Staphylococcus aureus (strain MRSA252)
Q04837 7.5e-18 78 35 2 111 1 SSBP1 Single-stranded DNA-binding protein, mitochondrial Homo sapiens
Q8XH44 8.84e-18 78 34 4 135 3 ssb Single-stranded DNA-binding protein Clostridium perfringens (strain 13 / Type A)
Q95KK4 8.9e-18 78 35 2 111 2 SSBP1 Single-stranded DNA-binding protein, mitochondrial Oryctolagus cuniculus
Q932A8 1.25e-17 77 39 3 108 3 ssb-p Single-stranded DNA-binding protein 2 Staphylococcus aureus (strain Mu50 / ATCC 700699)
Q8DSD8 1.33e-17 78 32 4 168 3 ssb Single-stranded DNA-binding protein Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
Q8NVN2 2.19e-17 77 33 8 169 3 ssb Single-stranded DNA-binding protein Staphylococcus aureus (strain MW2)
Q6G7V6 2.19e-17 77 33 8 169 3 ssb1 Single-stranded DNA-binding protein 1 Staphylococcus aureus (strain MSSA476)
Q928X8 3.1e-17 77 34 2 115 3 ssb3 Single-stranded DNA-binding protein 3 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q99SQ9 3.11e-17 77 34 6 167 3 ssb Single-stranded DNA-binding protein Staphylococcus aureus (strain N315)
P28042 4.62e-17 76 33 2 111 1 Ssbp1 Single-stranded DNA-binding protein, mitochondrial Rattus norvegicus
Q8YAR8 8.86e-17 76 37 3 111 3 ssb1 Single-stranded DNA-binding protein 1 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
P9WGD5 9.1e-17 76 36 2 109 1 ssb Single-stranded DNA-binding protein Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WGD4 9.1e-17 76 36 2 109 3 ssb Single-stranded DNA-binding protein Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
P0A611 9.1e-17 76 36 2 109 3 ssb Single-stranded DNA-binding protein Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
Q5HJ26 1.02e-16 75 38 3 108 3 ssb-p Single-stranded DNA-binding protein 2 Staphylococcus aureus (strain COL)
Q9CYR0 1.1e-16 75 34 2 106 1 Ssbp1 Single-stranded DNA-binding protein, mitochondrial Mus musculus
Q9AFI5 1.83e-16 75 36 2 109 1 ssb Single-stranded DNA-binding protein Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q32PB0 1.91e-16 75 34 2 111 2 SSBP1 Single-stranded DNA-binding protein, mitochondrial Bos taurus
Q6GCA6 2.93e-16 75 36 3 108 3 ssb2 Single-stranded DNA-binding protein 2 Staphylococcus aureus (strain MSSA476)
Q5HIS8 2.93e-16 75 36 3 108 3 ssb Single-stranded DNA-binding protein 1 Staphylococcus aureus (strain COL)
Q8KSB6 3.06e-16 75 34 2 114 3 ssb Single-stranded DNA-binding protein Paenarthrobacter aurescens
Q97HT8 4.15e-16 73 39 2 99 3 ssb2 Single-stranded DNA-binding protein 2 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
B8A5I7 4.19e-16 74 33 2 108 1 ssbp1 Single-stranded DNA-binding protein, mitochondrial Danio rerio
Q92FR5 8.4e-16 74 36 3 117 3 ssb1 Single-stranded DNA-binding protein 1 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q9KH06 1.01e-15 75 36 2 100 1 ssb Single-stranded DNA-binding protein Thermus aquaticus
Q9KH06 4.03e-10 60 39 2 99 1 ssb Single-stranded DNA-binding protein Thermus aquaticus
Q8GAN5 1.11e-15 73 32 4 153 3 ssb Single-stranded DNA-binding protein Paenarthrobacter nicotinovorans
Q97CX3 1.19e-15 72 30 6 168 3 ssb3 Single-stranded DNA-binding protein 3 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q8P2H3 1.21e-15 72 36 3 119 3 ssb1 Single-stranded DNA-binding protein 1 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q8E0Z9 2.33e-15 72 30 6 168 3 ssb3 Single-stranded DNA-binding protein 3 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q899R2 3.5e-15 71 37 2 101 3 ssb Single-stranded DNA-binding protein Clostridium tetani (strain Massachusetts / E88)
Q5SLP9 4.13e-15 73 35 2 104 1 ssb Single-stranded DNA-binding protein Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q5SLP9 3.72e-12 65 39 3 98 1 ssb Single-stranded DNA-binding protein Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
Q9PPT7 4.38e-15 72 39 1 97 3 ssb Single-stranded DNA-binding protein Ureaplasma parvum serovar 3 (strain ATCC 700970)
P09380 4.66e-15 71 32 2 112 1 ssbp1-a Single-stranded DNA-binding protein 1-A, mitochondrial Xenopus laevis
P09381 6.09e-15 71 33 2 112 1 ssbp1-b Single-stranded DNA-binding protein 1-B, mitochondrial Xenopus laevis
C0SPB6 7.01e-15 70 35 2 99 1 ssbB Single-stranded DNA-binding protein B Bacillus subtilis (strain 168)
Q8DIU1 7.57e-15 70 36 2 101 3 ssb Single-stranded DNA-binding protein Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q9RY51 1.24e-14 73 29 4 180 1 ssb Single-stranded DNA-binding protein Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q9RY51 1.05e-11 65 41 2 101 1 ssb Single-stranded DNA-binding protein Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
P46390 1.27e-14 70 34 2 109 1 ssb Single-stranded DNA-binding protein Mycobacterium leprae (strain TN)
O85824 1.4e-14 72 35 2 104 3 ssb Single-stranded DNA-binding protein Thermus thermophilus
O85824 3.39e-12 65 39 3 98 3 ssb Single-stranded DNA-binding protein Thermus thermophilus
O83101 2.32e-14 70 33 3 121 3 ssb Single-stranded DNA-binding protein Treponema pallidum (strain Nichols)
Q8KAM2 1.11e-13 67 33 3 122 3 ssb2 Single-stranded DNA-binding protein 2 Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
P0A4K1 1.12e-13 67 32 5 123 3 ssb1 Single-stranded DNA-binding protein Anabaena variabilis
P0A4K0 1.12e-13 67 32 5 123 3 ssb1 Single-stranded DNA-binding protein 1 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q8DXI7 2.2e-13 67 30 6 168 3 ssb4 Single-stranded DNA-binding protein 4 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q8E7H6 2.23e-13 66 37 4 111 3 ssb2 Single-stranded DNA-binding protein 2 Streptococcus agalactiae serotype III (strain NEM316)
O51141 2.89e-13 66 28 5 179 3 ssb Single-stranded DNA-binding protein Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
Q8E220 3.37e-13 66 37 4 111 3 ssb2 Single-stranded DNA-binding protein 2 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q5XE77 2.09e-12 63 37 4 111 3 ssb1 Single-stranded DNA-binding protein 1 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
Q8ZSD2 3.02e-12 63 30 3 110 3 ssb2 Single-stranded DNA-binding protein 2 Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
Q9X8U3 3.88e-12 64 31 2 109 1 ssb2 Single-stranded DNA-binding protein 2 Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q890K1 5.49e-12 64 38 2 89 3 ssb Single-stranded DNA-binding protein Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)
O66475 5.6e-12 63 36 1 87 3 ssb Single-stranded DNA-binding protein Aquifex aeolicus (strain VF5)
Q82FG5 9.37e-12 63 31 2 109 3 ssb1 Single-stranded DNA-binding protein 1 Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q83N34 4.31e-11 61 31 2 111 3 ssb1 Single-stranded DNA-binding protein 1 Tropheryma whipplei (strain Twist)
Q83NU2 4.69e-11 61 31 2 111 3 ssb1 Single-stranded DNA-binding protein 1 Tropheryma whipplei (strain TW08/27)
Q97KH4 7.18e-11 59 34 4 109 3 ssb1 Single-stranded DNA-binding protein 1 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
P54622 8.89e-11 60 30 3 105 1 mtSSB Single-stranded DNA-binding protein, mitochondrial Drosophila melanogaster
Q8NLG0 1.72e-10 60 29 2 110 3 ssb Single-stranded DNA-binding protein Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q8G757 3.1e-10 60 31 3 138 3 ssb Single-stranded DNA-binding protein Bifidobacterium longum (strain NCC 2705)
Q84J78 4.09e-10 59 30 3 114 2 At4g11060 Single-stranded DNA-binding protein, mitochondrial Arabidopsis thaliana
Q8FLP9 6.61e-10 59 28 2 111 3 ssb Single-stranded DNA-binding protein Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
Q8RE26 1.07e-09 57 29 2 99 3 ssb Single-stranded DNA-binding protein Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q8F052 1.36e-09 56 32 1 100 3 ssb Single-stranded DNA-binding protein Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72UU3 1.36e-09 56 32 1 100 3 ssb Single-stranded DNA-binding protein Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q8EWT6 7.32e-09 55 31 1 99 3 ssb Single-stranded DNA-binding protein Malacoplasma penetrans (strain HF-2)
P60471 1.82e-08 53 33 3 102 3 ssb Single-stranded DNA-binding protein Onion yellows phytoplasma (strain OY-M)
P34496 8.6e-08 52 37 1 81 1 mtss-1 Single-stranded DNA-binding protein, mitochondrial Caenorhabditis elegans

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_16775
Feature type CDS
Gene ssb
Product Single-stranded DNA-binding protein
Location 32308 - 32826 (strand: 1)
Length 519 (nucleotides) / 172 (amino acids)
In genomic island -

Contig

Accession ZDB_534
Length 68509 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_443
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF00436 Single-strand binding protein family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0629 Replication, recombination and repair (L) L Single-stranded DNA-binding protein

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K03111 single-strand DNA-binding protein DNA replication
Mismatch repair
Homologous recombination
-

Protein Sequence

MASRGVNKVILIGNLGQDPEVRYMPNGGAVTNITLATSESWRDKQTGEMKEKTEWHRVVIFGKLAEIAGEYLKKGSQVYIEGSLQTRKWQDQSGQERYTTEVVVNIGGSMQMLGGRSGGGDNMSQGGGWGQPQQPQQGQQFSGGGNPRPAQQPAAAPQSNEPPMDFDDDIPF

Flanking regions ( +/- flanking 50bp)

TTAGACTAGATCCTTATATTGTTACAGACAAATTTCATCGGGAGCATTTCATGGCCAGCAGAGGCGTCAACAAAGTCATTCTTATCGGGAACCTGGGTCAGGATCCGGAAGTGCGTTACATGCCTAACGGCGGTGCGGTTACCAACATCACACTGGCGACATCAGAATCATGGCGTGATAAACAAACCGGCGAAATGAAAGAGAAGACCGAATGGCACCGTGTGGTGATCTTCGGCAAACTGGCAGAAATTGCCGGTGAATATCTGAAAAAAGGTTCACAGGTTTATATCGAAGGTTCACTCCAGACCCGCAAATGGCAGGATCAGAGCGGCCAGGAGCGTTACACCACAGAAGTCGTGGTGAATATCGGCGGCAGCATGCAGATGCTGGGCGGCCGCAGCGGCGGTGGCGACAATATGTCTCAGGGCGGCGGCTGGGGTCAGCCACAGCAGCCACAACAAGGCCAGCAGTTCAGCGGCGGCGGCAACCCGCGCCCGGCACAGCAGCCGGCAGCAGCACCGCAAAGCAATGAACCGCCAATGGATTTCGATGACGATATTCCGTTCTGATCCGGATCCGCTGAAAGTACCCTGCATCTGCGGGGTATTTTTTTGCCCGG