Homologs in group_2003

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14745 FBDBKF_14745 100.0 Morganella morganii S1 maf 7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily
EHELCC_15550 EHELCC_15550 100.0 Morganella morganii S2 maf 7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily
LHKJJB_15760 LHKJJB_15760 100.0 Morganella morganii S3 maf 7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily
HKOGLL_14880 HKOGLL_14880 100.0 Morganella morganii S5 maf 7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily
F4V73_RS07540 F4V73_RS07540 86.2 Morganella psychrotolerans - nucleoside triphosphate pyrophosphatase
PMI_RS04195 PMI_RS04195 63.8 Proteus mirabilis HI4320 - nucleoside triphosphate pyrophosphatase

Distribution of the homologs in the orthogroup group_2003

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2003

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N380 5.32e-91 267 66 0 192 3 plu2839 7-methyl-GTP pyrophosphatase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q669K7 3.76e-85 252 63 0 194 3 YPTB2477 7-methyl-GTP pyrophosphatase Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CI15 6.71e-85 252 62 0 194 3 YPN_2036 7-methyl-GTP pyrophosphatase Yersinia pestis bv. Antiqua (strain Nepal516)
P58635 6.71e-85 252 62 0 194 3 YPO1593 7-methyl-GTP pyrophosphatase Yersinia pestis
Q1C6M4 6.71e-85 252 62 0 194 3 YPA_1932 7-methyl-GTP pyrophosphatase Yersinia pestis bv. Antiqua (strain Antiqua)
Q57QG8 7.88e-80 239 62 0 193 3 yceF1 7-methyl-GTP pyrophosphatase Salmonella choleraesuis (strain SC-B67)
Q6D694 9.6e-80 239 60 0 194 3 ECA1791 7-methyl-GTP pyrophosphatase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
P58627 1.77e-79 238 62 0 193 1 yceF 7-methyl-GTP pyrophosphatase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P58626 2.93e-79 237 62 0 192 3 yceF 7-methyl-GTP pyrophosphatase Escherichia coli O157:H7
Q3Z330 4.09e-78 234 61 0 192 3 yceF1 7-methyl-GTP pyrophosphatase Shigella sonnei (strain Ss046)
P0A730 4.09e-78 234 61 0 192 3 yceF 7-methyl-GTP pyrophosphatase Shigella flexneri
Q1RD70 4.09e-78 234 61 0 192 3 yceF1 7-methyl-GTP pyrophosphatase Escherichia coli (strain UTI89 / UPEC)
P0A729 4.09e-78 234 61 0 192 1 yceF 7-methyl-GTP pyrophosphatase Escherichia coli (strain K12)
Q0TIY7 4.09e-78 234 61 0 192 3 yceF1 7-methyl-GTP pyrophosphatase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q5PGT7 9.7e-78 233 61 0 192 3 yceF1 7-methyl-GTP pyrophosphatase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
P58628 1.26e-77 233 61 0 192 3 yceF 7-methyl-GTP pyrophosphatase Salmonella typhi
Q31ZE2 3.38e-77 232 61 0 192 3 yceF1 7-methyl-GTP pyrophosphatase Shigella boydii serotype 4 (strain Sb227)
Q8FIP6 4.34e-77 232 61 0 192 3 yceF 7-methyl-GTP pyrophosphatase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q8EDG7 1.43e-74 226 59 0 189 3 SO_2782 7-methyl-GTP pyrophosphatase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
Q482K5 4.19e-73 222 57 0 192 3 CPS_2292 7-methyl-GTP pyrophosphatase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q6LSX6 6.48e-73 221 57 0 189 3 PBPRA1189 7-methyl-GTP pyrophosphatase Photobacterium profundum (strain SS9)
Q3JAF4 1.11e-72 221 59 0 187 3 Noc_1720 7-methyl-GTP pyrophosphatase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q2NU46 1.17e-72 221 58 0 193 3 SG1054 7-methyl-GTP pyrophosphatase Sodalis glossinidius (strain morsitans)
Q0HTU8 3.45e-72 219 57 0 189 3 Shewmr7_2472 7-methyl-GTP pyrophosphatase Shewanella sp. (strain MR-7)
Q9KQH1 6.94e-69 211 57 1 187 3 VC_2027 7-methyl-GTP pyrophosphatase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q0HHJ4 1.79e-68 210 57 0 189 3 Shewmr4_2402 7-methyl-GTP pyrophosphatase Shewanella sp. (strain MR-4)
Q0VQN6 2.7e-65 202 53 0 188 3 ABO_1064 7-methyl-GTP pyrophosphatase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q87YG2 6.43e-64 198 55 0 190 3 maf-1 7-methyl-GTP pyrophosphatase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q7MM04 9.2e-64 198 58 1 171 3 VV1269 7-methyl-GTP pyrophosphatase Vibrio vulnificus (strain YJ016)
Q8D8G2 9.2e-64 198 58 1 171 3 VV1_3015 7-methyl-GTP pyrophosphatase Vibrio vulnificus (strain CMCP6)
Q87N16 3.16e-63 197 53 1 189 3 VP2060 7-methyl-GTP pyrophosphatase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q084H1 3.33e-63 197 53 1 194 3 Sfri_1493 7-methyl-GTP pyrophosphatase Shewanella frigidimarina (strain NCIMB 400)
Q3IHD5 5.24e-63 196 51 0 189 3 PSHAa1813 7-methyl-GTP pyrophosphatase Pseudoalteromonas translucida (strain TAC 125)
Q5E405 1.36e-62 195 52 0 189 3 VF_1746 7-methyl-GTP pyrophosphatase Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q1QX59 7.33e-62 193 52 0 192 3 Csal_1596 7-methyl-GTP pyrophosphatase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q9HZN2 8.64e-62 193 52 0 188 3 PA2972 7-methyl-GTP pyrophosphatase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q606K9 1.19e-60 190 53 0 182 3 MCA2007 7-methyl-GTP pyrophosphatase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q15TZ2 1.54e-60 190 56 2 185 3 Patl_2128 7-methyl-GTP pyrophosphatase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
Q31HS1 5.01e-60 189 49 0 183 3 Tcr_0706 7-methyl-GTP pyrophosphatase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q12LU7 1.78e-59 187 51 1 198 3 Sden_2299 7-methyl-GTP pyrophosphatase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q48L46 2.28e-59 187 54 0 168 3 PSPPH_1636 7-methyl-GTP pyrophosphatase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q4ZVY2 3.53e-59 186 54 0 168 3 Psyr_1642 7-methyl-GTP pyrophosphatase Pseudomonas syringae pv. syringae (strain B728a)
Q4KFS2 5.45e-59 186 53 0 188 3 PFL_1791 7-methyl-GTP pyrophosphatase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q3K8K5 6.15e-59 186 52 0 190 3 Pfl01_4162 7-methyl-GTP pyrophosphatase Pseudomonas fluorescens (strain Pf0-1)
Q0A8R1 6.8e-59 186 50 0 186 3 Mlg_1427 7-methyl-GTP pyrophosphatase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q1H156 2.57e-58 184 48 0 190 3 Mfla_1513 7-methyl-GTP pyrophosphatase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q88LM1 4.62e-57 181 48 0 188 3 maf-2 7-methyl-GTP pyrophosphatase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q47EH5 2.67e-56 179 53 0 181 3 Daro_2011 7-methyl-GTP pyrophosphatase Dechloromonas aromatica (strain RCB)
Q5P0E0 3.97e-55 176 49 0 185 3 AZOSEA30990 7-methyl-GTP pyrophosphatase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q2SK56 1.07e-54 175 49 2 194 3 HCH_02139 7-methyl-GTP pyrophosphatase Hahella chejuensis (strain KCTC 2396)
Q5QZ35 1.7e-54 174 47 1 191 3 IL1346 7-methyl-GTP pyrophosphatase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q6FB05 6.34e-54 173 48 1 186 3 ACIAD1930 Nucleoside triphosphate pyrophosphatase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q3SIL8 2.13e-53 172 50 0 193 3 Tbd_1557 7-methyl-GTP pyrophosphatase Thiobacillus denitrificans (strain ATCC 25259)
Q126I4 1.35e-51 168 47 0 185 3 Bpro_3654 7-methyl-GTP pyrophosphatase Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q3A587 1.44e-51 167 50 1 193 3 Pcar_1221 7-methyl-GTP pyrophosphatase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q2KUK9 1.81e-51 167 45 2 192 3 BAV1115 7-methyl-GTP pyrophosphatase Bordetella avium (strain 197N)
Q1LKL5 1.22e-50 165 47 0 187 3 Rmet_2434 7-methyl-GTP pyrophosphatase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q7NSK3 2.41e-49 161 44 1 193 3 CV_3420 7-methyl-GTP pyrophosphatase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q21XP8 3.51e-49 161 47 0 189 3 Rfer_1726 7-methyl-GTP pyrophosphatase Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
Q82U64 2.52e-48 159 47 2 176 3 NE1642 7-methyl-GTP pyrophosphatase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q21K93 7.75e-47 155 42 0 190 3 Sde_1624 7-methyl-GTP pyrophosphatase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q46Z01 8.97e-47 155 47 0 186 3 Reut_A2269 7-methyl-GTP pyrophosphatase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q8PBV4 9.66e-47 155 45 1 190 3 XCC1013 7-methyl-GTP pyrophosphatase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4URP7 9.66e-47 155 45 1 190 3 XC_3232 7-methyl-GTP pyrophosphatase Xanthomonas campestris pv. campestris (strain 8004)
Q2YA50 1.29e-46 154 46 0 185 3 Nmul_A1068 7-methyl-GTP pyrophosphatase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
Q13VL1 3.04e-46 154 44 1 189 3 Bxeno_A3340 7-methyl-GTP pyrophosphatase Paraburkholderia xenovorans (strain LB400)
Q8PNF1 3.82e-46 153 44 2 190 3 XAC1120 7-methyl-GTP pyrophosphatase Xanthomonas axonopodis pv. citri (strain 306)
Q1BXV8 6.12e-46 153 49 4 191 3 Bcen_0637 7-methyl-GTP pyrophosphatase Burkholderia orbicola (strain AU 1054)
P58633 6.65e-46 152 46 0 186 3 RSc1046 7-methyl-GTP pyrophosphatase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q7VW25 7.95e-45 150 45 2 189 3 BP2447 7-methyl-GTP pyrophosphatase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q39I90 1.07e-44 150 49 2 189 3 Bcep18194_A4229 7-methyl-GTP pyrophosphatase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
Q7W5I0 2.43e-44 149 44 2 189 3 BPP3311 7-methyl-GTP pyrophosphatase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WD16 2.43e-44 149 44 2 189 3 BB3762 7-methyl-GTP pyrophosphatase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q2SXV1 8.94e-43 145 48 1 189 3 BTH_I1713 7-methyl-GTP pyrophosphatase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63S79 1.05e-42 145 48 2 189 3 BPSL2446 7-methyl-GTP pyrophosphatase Burkholderia pseudomallei (strain K96243)
Q3JQ61 1.05e-42 145 48 2 189 3 BURPS1710b_2911 7-methyl-GTP pyrophosphatase Burkholderia pseudomallei (strain 1710b)
Q62LU6 1.05e-42 145 48 2 189 3 BMA0526 7-methyl-GTP pyrophosphatase Burkholderia mallei (strain ATCC 23344)
Q5F4W9 1.18e-42 144 41 1 192 3 NGO2175 7-methyl-GTP pyrophosphatase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q9JXS2 7.75e-41 140 40 1 192 3 NMB1909 7-methyl-GTP pyrophosphatase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q9JW50 1.22e-40 139 39 1 192 3 NMA0546 7-methyl-GTP pyrophosphatase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q2P7C2 4.66e-39 135 44 2 190 3 XOO0800 7-methyl-GTP pyrophosphatase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q5H4J1 4.8e-39 135 44 2 190 3 XOO0876 7-methyl-GTP pyrophosphatase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
A5D426 4.31e-34 122 37 1 192 3 PTH_0815 dTTP/UTP pyrophosphatase Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
P25536 4.2e-32 117 38 4 197 1 yhdE dTTP/UTP pyrophosphatase Escherichia coli (strain K12)
Q67SI8 5.97e-32 117 37 2 189 3 STH370 dTTP/UTP pyrophosphatase Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
P58629 2.16e-31 115 38 4 197 3 yhdE dTTP/UTP pyrophosphatase Escherichia coli O157:H7
Q1DAV2 2.37e-31 115 35 2 190 3 MXAN_1986 Nucleoside triphosphate pyrophosphatase Myxococcus xanthus (strain DK1622)
Q3YX01 1.09e-30 114 37 4 197 3 yceF2 dTTP/UTP pyrophosphatase Shigella sonnei (strain Ss046)
Q1R692 1.24e-30 114 37 4 197 3 yceF2 dTTP/UTP pyrophosphatase Escherichia coli (strain UTI89 / UPEC)
Q8FD47 1.24e-30 114 37 4 197 3 yhdE dTTP/UTP pyrophosphatase Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCL8 1.24e-30 114 37 4 197 3 yceF2 dTTP/UTP pyrophosphatase Escherichia coli O6:K15:H31 (strain 536 / UPEC)
Q83JE1 2.04e-30 113 37 4 197 3 yhdE Nucleoside triphosphate pyrophosphatase Shigella flexneri
Q9K8H3 9.1e-30 111 36 2 190 3 maf dTTP/UTP pyrophosphatase Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
P74331 1.4e-29 111 37 3 190 3 sll0905 Nucleoside triphosphate pyrophosphatase Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa)
B0JH94 2.32e-29 110 36 1 188 3 MAE_24240 Nucleoside triphosphate pyrophosphatase Microcystis aeruginosa (strain NIES-843 / IAM M-2473)
Q32B92 3.79e-29 110 37 4 197 3 yceF dTTP/UTP pyrophosphatase Shigella dysenteriae serotype 1 (strain Sd197)
Q31WB6 4e-29 110 36 4 197 3 yceF2 dTTP/UTP pyrophosphatase Shigella boydii serotype 4 (strain Sb227)
Q5KWN2 6.81e-29 108 34 2 187 3 maf dTTP/UTP pyrophosphatase Geobacillus kaustophilus (strain HTA426)
Q2LSD6 2.69e-28 108 34 1 185 3 SYNAS_11200 dTTP/UTP pyrophosphatase Syntrophus aciditrophicus (strain SB)
Q1D912 5.28e-28 107 36 2 185 3 MXAN_2642 dTTP/UTP pyrophosphatase Myxococcus xanthus (strain DK1622)
Q46BZ6 1.12e-27 106 32 2 191 3 Mbar_A1652 dTTP/UTP pyrophosphatase Methanosarcina barkeri (strain Fusaro / DSM 804)
Q8TSP7 1.94e-27 105 34 2 191 3 MA_0748 dTTP/UTP pyrophosphatase Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A)
B7K400 6.96e-27 104 35 1 187 3 PCC8801_2532 Nucleoside triphosphate pyrophosphatase Rippkaea orientalis (strain PCC 8801 / RF-1)
Q5X3L5 6.99e-27 104 32 4 194 3 lpp2019 Nucleoside triphosphate pyrophosphatase Legionella pneumophila (strain Paris)
Q6AMI5 7.57e-27 103 32 1 182 3 DP1711 dTTP/UTP pyrophosphatase Desulfotalea psychrophila (strain LSv54 / DSM 12343)
Q88PB4 9.51e-27 103 35 3 189 3 maf-1 dTTP/UTP pyrophosphatase Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
Q5WV03 9.95e-27 103 33 4 188 3 lpl2014 Nucleoside triphosphate pyrophosphatase Legionella pneumophila (strain Lens)
Q3MEX6 1.29e-26 103 33 1 187 3 Ava_0836 Nucleoside triphosphate pyrophosphatase Trichormus variabilis (strain ATCC 29413 / PCC 7937)
Q5ZTX2 1.97e-26 103 34 4 188 3 lpg2036 Nucleoside triphosphate pyrophosphatase Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
Q6FDX8 2.54e-26 102 33 2 179 3 ACIAD0829 dTTP/UTP pyrophosphatase Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q1IYX1 2.6e-26 102 35 3 185 3 Dgeo_1267 dTTP/UTP pyrophosphatase Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
Q8PVQ2 3.09e-26 102 31 2 191 3 MM_1910 dTTP/UTP pyrophosphatase Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88)
A4XKL5 4.15e-26 102 31 2 197 3 Csac_1865 dTTP/UTP pyrophosphatase Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
Q18B07 5.46e-26 102 34 3 185 3 CD630_11430 dTTP/UTP pyrophosphatase Clostridioides difficile (strain 630)
B9MRU6 5.91e-26 102 31 2 197 3 Athe_1300 dTTP/UTP pyrophosphatase Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / KCTC 15123 / Z-1320)
Q5PJV0 8.45e-26 101 35 4 197 3 yceF2 dTTP/UTP pyrophosphatase Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q2JNH4 9.81e-26 101 36 2 188 3 CYB_0709 Nucleoside triphosphate pyrophosphatase Synechococcus sp. (strain JA-2-3B'a(2-13))
Q6MKE8 9.99e-26 100 34 3 187 3 Bd2448 7-methyl-GTP pyrophosphatase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
A5IDM1 1.42e-25 100 33 4 188 3 LPC_1522 Nucleoside triphosphate pyrophosphatase Legionella pneumophila (strain Corby)
P58630 1.47e-25 100 35 4 197 3 yhdE dTTP/UTP pyrophosphatase Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57J97 1.47e-25 100 35 4 197 3 yceF2 dTTP/UTP pyrophosphatase Salmonella choleraesuis (strain SC-B67)
Q11A17 1.65e-25 100 32 4 196 3 Tery_0163 Nucleoside triphosphate pyrophosphatase Trichodesmium erythraeum (strain IMS101)
Q0AWG2 1.92e-25 100 32 1 188 3 Swol_1643 dTTP/UTP pyrophosphatase Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen)
P58631 4.97e-25 99 35 4 197 3 yhdE dTTP/UTP pyrophosphatase Salmonella typhi
B5YF11 6.42e-25 99 32 4 192 3 DICTH_1299 dTTP/UTP pyrophosphatase Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
Q12TU6 8.25e-25 99 33 2 189 3 Mbur_2269 dTTP/UTP pyrophosphatase Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M)
P58632 9.23e-25 98 33 1 187 3 all3075 Nucleoside triphosphate pyrophosphatase Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)
B8I6Q1 1.52e-24 98 33 3 189 3 Ccel_2565 dTTP/UTP pyrophosphatase Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10)
Q8EA14 2.44e-24 97 36 5 197 3 SO_4095 dTTP/UTP pyrophosphatase Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
B8E0U2 2.54e-24 97 32 2 190 3 Dtur_1405 dTTP/UTP pyrophosphatase Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
Q2S4I1 4.83e-24 97 34 2 179 3 SRU_0763 dTTP/UTP pyrophosphatase Salinibacter ruber (strain DSM 13855 / M31)
Q5SJ26 5.39e-24 96 35 5 190 3 TTHA1188 dTTP/UTP pyrophosphatase Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
B0C1T2 5.4e-24 97 34 2 190 3 AM1_1059 Nucleoside triphosphate pyrophosphatase Acaryochloris marina (strain MBIC 11017)
A7HA27 6.18e-24 96 35 4 191 3 Anae109_1366 dTTP/UTP pyrophosphatase Anaeromyxobacter sp. (strain Fw109-5)
B2J6P8 6.56e-24 96 34 1 187 3 Npun_F5518 Nucleoside triphosphate pyrophosphatase Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
A7Z794 6.86e-24 96 34 3 188 3 maf dTTP/UTP pyrophosphatase Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q72JE7 7.12e-24 96 35 5 190 3 TT_C0825 dTTP/UTP pyrophosphatase Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27)
Q8DJC5 1.01e-23 96 37 2 175 3 tlr1302 Nucleoside triphosphate pyrophosphatase Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1)
Q9RV24 1.47e-23 95 32 4 191 3 DR_1206 dTTP/UTP pyrophosphatase Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
B7KJY0 1.47e-23 95 32 1 191 3 PCC7424_1128 Nucleoside triphosphate pyrophosphatase Gloeothece citriformis (strain PCC 7424)
Q47VG7 1.75e-23 95 35 3 191 3 CPS_4557 dTTP/UTP pyrophosphatase Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q65GL2 1.79e-23 95 34 4 185 3 maf dTTP/UTP pyrophosphatase Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
B0K437 2e-23 95 31 4 187 3 Teth514_2136 dTTP/UTP pyrophosphatase Thermoanaerobacter sp. (strain X514)
B0KAE1 2e-23 95 31 4 187 3 Teth39_1454 dTTP/UTP pyrophosphatase Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
Q0HEI2 2.04e-23 95 36 5 197 3 Shewmr4_3469 dTTP/UTP pyrophosphatase Shewanella sp. (strain MR-4)
Q0HZH0 2.22e-23 95 36 5 197 3 Shewmr7_0482 dTTP/UTP pyrophosphatase Shewanella sp. (strain MR-7)
Q817R9 3.34e-23 94 32 2 186 3 maf dTTP/UTP pyrophosphatase Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
C6E559 5.71e-23 94 33 1 182 3 GM21_1532 dTTP/UTP pyrophosphatase Geobacter sp. (strain M21)
B4UJ23 6.22e-23 94 35 3 188 3 AnaeK_1353 dTTP/UTP pyrophosphatase Anaeromyxobacter sp. (strain K)
A5G7S1 9.23e-23 93 33 1 186 3 Gura_3686 dTTP/UTP pyrophosphatase Geotalea uraniireducens (strain Rf4)
Q87LC4 1.03e-22 93 34 4 186 3 VP2688 dTTP/UTP pyrophosphatase Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q72ZX1 1.25e-22 93 32 2 186 3 maf dTTP/UTP pyrophosphatase Bacillus cereus (strain ATCC 10987 / NRS 248)
B7IIW6 1.39e-22 92 32 2 186 3 maf dTTP/UTP pyrophosphatase Bacillus cereus (strain G9842)
Q3AF81 1.42e-22 92 30 2 188 3 CHY_0340 dTTP/UTP pyrophosphatase Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
Q7MHE0 1.48e-22 92 34 3 185 3 VV2931 dTTP/UTP pyrophosphatase Vibrio vulnificus (strain YJ016)
Q8DCG8 1.48e-22 92 34 3 185 3 VV1_1452 dTTP/UTP pyrophosphatase Vibrio vulnificus (strain CMCP6)
B7HE87 1.75e-22 92 32 2 186 3 maf dTTP/UTP pyrophosphatase Bacillus cereus (strain B4264)
Q633Y9 1.87e-22 92 32 2 186 3 maf dTTP/UTP pyrophosphatase Bacillus cereus (strain ZK / E33L)
B8HN65 1.9e-22 92 34 2 192 3 Cyan7425_4892 Nucleoside triphosphate pyrophosphatase Cyanothece sp. (strain PCC 7425 / ATCC 29141)
Q81LD6 2.01e-22 92 32 2 186 3 maf dTTP/UTP pyrophosphatase Bacillus anthracis
C3L6Y6 2.01e-22 92 32 2 186 3 maf dTTP/UTP pyrophosphatase Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P9E0 2.01e-22 92 32 2 186 3 maf dTTP/UTP pyrophosphatase Bacillus anthracis (strain A0248)
B8JH92 2.25e-22 92 35 3 188 3 A2cp1_1450 dTTP/UTP pyrophosphatase Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
C1ETQ1 2.34e-22 92 32 2 186 3 maf dTTP/UTP pyrophosphatase Bacillus cereus (strain 03BB102)
B7JQ48 2.34e-22 92 32 2 186 3 maf dTTP/UTP pyrophosphatase Bacillus cereus (strain AH820)
Q6HD71 3.22e-22 92 32 2 186 3 maf dTTP/UTP pyrophosphatase Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q2IKU4 3.37e-22 92 35 3 188 3 Adeh_2502 dTTP/UTP pyrophosphatase Anaeromyxobacter dehalogenans (strain 2CP-C)
Q2RL24 3.56e-22 92 35 3 194 3 Moth_0535 dTTP/UTP pyrophosphatase Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q39X87 3.66e-22 92 34 3 187 3 Gmet_0895 dTTP/UTP pyrophosphatase Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
C5D5H8 3.69e-22 91 33 3 189 3 maf dTTP/UTP pyrophosphatase Geobacillus sp. (strain WCH70)
Q31FH4 4.07e-22 91 31 4 191 3 Tcr_1507 dTTP/UTP pyrophosphatase Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q47JQ0 4.39e-22 92 33 5 204 3 Daro_0172 dTTP/UTP pyrophosphatase Dechloromonas aromatica (strain RCB)
A9VIS9 6.98e-22 91 31 2 186 3 maf dTTP/UTP pyrophosphatase Bacillus mycoides (strain KBAB4)
Q8FRM5 7.28e-22 91 31 4 194 3 CE0735 Nucleoside triphosphate pyrophosphatase Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395)
B5EHR3 8.13e-22 90 32 1 182 3 Gbem_2708 dTTP/UTP pyrophosphatase Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q4JTL6 8.86e-22 90 31 4 197 3 jk1664 Nucleoside triphosphate pyrophosphatase Corynebacterium jeikeium (strain K411)
Q3KI22 9.1e-22 90 34 3 187 3 Pfl01_0841 dTTP/UTP pyrophosphatase Pseudomonas fluorescens (strain Pf0-1)
A2BS59 1.27e-21 90 32 4 197 3 A9601_13361 Nucleoside triphosphate pyrophosphatase Prochlorococcus marinus (strain AS9601)
Q02169 1.87e-21 90 31 2 174 1 maf dTTP/UTP pyrophosphatase Bacillus subtilis (strain 168)
A8G5U9 2.07e-21 90 31 5 197 3 P9215_13651 Nucleoside triphosphate pyrophosphatase Prochlorococcus marinus (strain MIT 9215)
Q6A725 2.14e-21 90 35 4 186 3 PPA1709 Nucleoside triphosphate pyrophosphatase Cutibacterium acnes (strain DSM 16379 / KPA171202)
Q2SBH1 2.69e-21 89 33 4 189 3 HCH_05331 dTTP/UTP pyrophosphatase Hahella chejuensis (strain KCTC 2396)
A9KHL6 2.92e-21 89 30 4 197 3 Cphy_1933 dTTP/UTP pyrophosphatase Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
Q5N2H7 3.77e-21 89 34 1 170 3 syc1303_d Nucleoside triphosphate pyrophosphatase Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1)
Q31RS8 3.77e-21 89 34 1 170 3 Synpcc7942_0209 Nucleoside triphosphate pyrophosphatase Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805)
O67613 3.89e-21 89 31 4 184 3 aq_1718 dTTP/UTP pyrophosphatase Aquifex aeolicus (strain VF5)
B7HQL2 4.2e-21 89 32 2 186 3 maf dTTP/UTP pyrophosphatase Bacillus cereus (strain AH187)
Q74A46 8.1e-21 88 33 3 187 3 GSU2545 dTTP/UTP pyrophosphatase Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A3PDZ9 8.18e-21 88 32 5 197 3 P9301_13511 Nucleoside triphosphate pyrophosphatase Prochlorococcus marinus (strain MIT 9301)
Q7U5K1 8.38e-21 88 34 3 179 3 SYNW1702 Nucleoside triphosphate pyrophosphatase Parasynechococcus marenigrum (strain WH8102)
Q15ZH0 9.3e-21 88 32 3 185 3 Patl_0186 dTTP/UTP pyrophosphatase Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A3DBJ9 9.47e-21 88 32 3 200 3 Cthe_0087 dTTP/UTP pyrophosphatase Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
B7IFS5 1.1e-20 87 32 4 187 3 THA_448 dTTP/UTP pyrophosphatase Thermosipho africanus (strain TCF52B)
B9IZ30 1.26e-20 87 32 2 186 3 maf dTTP/UTP pyrophosphatase Bacillus cereus (strain Q1)
Q0S319 1.34e-20 88 32 7 207 3 RHA1_ro06290 Nucleoside triphosphate pyrophosphatase Rhodococcus jostii (strain RHA1)
Q5P2U3 1.34e-20 88 33 5 201 3 AZOSEA22460 dTTP/UTP pyrophosphatase Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
A7GTD6 1.38e-20 87 32 2 186 3 maf dTTP/UTP pyrophosphatase Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q8RBC6 1.4e-20 88 30 3 184 3 maf dTTP/UTP pyrophosphatase Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
A0PZG3 1.53e-20 87 30 5 193 3 NT01CX_1686 dTTP/UTP pyrophosphatase Clostridium novyi (strain NT)
A6L391 2.39e-20 87 36 6 185 3 BVU_2498 dTTP/UTP pyrophosphatase Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154)
A6LJI7 2.71e-20 86 32 4 183 3 Tmel_0214 dTTP/UTP pyrophosphatase Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429)
Q6MDL5 3.18e-20 87 30 3 188 3 pc0610 dTTP/UTP pyrophosphatase Protochlamydia amoebophila (strain UWE25)
Q2JXB4 3.33e-20 87 35 2 188 3 CYA_0360 Nucleoside triphosphate pyrophosphatase Synechococcus sp. (strain JA-3-3Ab)
A4X378 3.42e-20 87 33 3 178 3 Strop_0851 Nucleoside triphosphate pyrophosphatase Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / JCM 13857 / NBRC 105044 / CNB-440)
B1LB65 5.83e-20 86 31 4 197 3 TRQ2_1219 dTTP/UTP pyrophosphatase Thermotoga sp. (strain RQ2)
Q9X1P2 5.83e-20 86 31 4 197 3 TM_1556 dTTP/UTP pyrophosphatase Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
Q21CL6 5.95e-20 86 34 6 196 3 RPC_0295 Nucleoside triphosphate pyrophosphatase Rhodopseudomonas palustris (strain BisB18)
A5IM27 6.02e-20 86 32 4 190 3 Tpet_1236 dTTP/UTP pyrophosphatase Thermotoga petrophila (strain ATCC BAA-488 / DSM 13995 / JCM 10881 / RKU-1)
A8MHM5 6.88e-20 85 29 3 185 3 Clos_1767 dTTP/UTP pyrophosphatase Alkaliphilus oremlandii (strain OhILAs)
B4SA80 8.67e-20 85 32 4 187 3 Ppha_1527 dTTP/UTP pyrophosphatase Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1)
Q9UXZ1 9.81e-20 85 31 5 189 3 PYRAB17160 dTTP/UTP pyrophosphatase Pyrococcus abyssi (strain GE5 / Orsay)
Q3A7I0 1.07e-19 86 31 2 187 3 Pcar_0404 dTTP/UTP pyrophosphatase Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q7VB43 1.1e-19 85 31 5 203 3 maf Nucleoside triphosphate pyrophosphatase Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)
Q3J7T5 1.13e-19 85 34 3 184 3 Noc_2658 dTTP/UTP pyrophosphatase Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
A6TQH7 1.15e-19 85 31 6 191 3 Amet_2288 dTTP/UTP pyrophosphatase Alkaliphilus metalliredigens (strain QYMF)
C1B1A6 1.22e-19 85 32 6 196 3 ROP_63540 Nucleoside triphosphate pyrophosphatase Rhodococcus opacus (strain B4)
A5GMB7 1.31e-19 85 34 4 183 3 SynWH7803_1656 Nucleoside triphosphate pyrophosphatase Synechococcus sp. (strain WH7803)
Q319X8 1.38e-19 85 31 6 197 3 PMT9312_1258 Nucleoside triphosphate pyrophosphatase Prochlorococcus marinus (strain MIT 9312)
C4ZDP0 1.46e-19 85 32 6 207 3 EUBREC_3290 dTTP/UTP pyrophosphatase Agathobacter rectalis (strain ATCC 33656 / DSM 3377 / JCM 17463 / KCTC 5835 / VPI 0990)
B2UPE6 1.6e-19 84 31 2 187 3 Amuc_0586 dTTP/UTP pyrophosphatase Akkermansia muciniphila (strain ATCC BAA-835 / DSM 22959 / JCM 33894 / BCRC 81048 / CCUG 64013 / CIP 107961 / Muc)
A4QC50 1.75e-19 85 29 7 205 3 cgR_0825 Nucleoside triphosphate pyrophosphatase Corynebacterium glutamicum (strain R)
B2HEK5 2e-19 85 33 7 209 3 MMAR_1254 Nucleoside triphosphate pyrophosphatase Mycobacterium marinum (strain ATCC BAA-535 / M)
Q6NIW2 2.13e-19 84 32 7 200 3 DIP0654 Nucleoside triphosphate pyrophosphatase Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
A0QTE5 2.26e-19 85 30 4 192 3 MSMEG_1811 Nucleoside triphosphate pyrophosphatase Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155)
Q8NSH0 2.3e-19 84 29 7 205 3 Cgl0705 Nucleoside triphosphate pyrophosphatase Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / BCRC 11384 / CCUG 27702 / LMG 3730 / NBRC 12168 / NCIMB 10025 / NRRL B-2784 / 534)
Q892M0 2.57e-19 84 30 4 192 3 CTC_02076 dTTP/UTP pyrophosphatase Clostridium tetani (strain Massachusetts / E88)
Q665F6 3.18e-19 84 32 3 185 3 YPTB3562 dTTP/UTP pyrophosphatase Yersinia pseudotuberculosis serotype I (strain IP32953)
Q1CDV0 3.18e-19 84 32 3 185 3 YPN_3503 dTTP/UTP pyrophosphatase Yersinia pestis bv. Antiqua (strain Nepal516)
P58636 3.18e-19 84 32 3 185 3 YPO3668 dTTP/UTP pyrophosphatase Yersinia pestis
Q1C1M9 3.18e-19 84 32 3 185 3 YPA_3681 dTTP/UTP pyrophosphatase Yersinia pestis bv. Antiqua (strain Antiqua)
Q12IW9 3.36e-19 84 32 5 191 3 Sden_3331 dTTP/UTP pyrophosphatase Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
A9NE14 3.76e-19 84 32 3 182 3 ACL_1383 dTTP/UTP pyrophosphatase Acholeplasma laidlawii (strain PG-8A)
Q4ZNT2 4.6e-19 84 33 3 187 3 Psyr_4160 dTTP/UTP pyrophosphatase Pseudomonas syringae pv. syringae (strain B728a)
A4J7K7 5.74e-19 83 29 1 184 3 Dred_2550 dTTP/UTP pyrophosphatase Desulforamulus reducens (strain ATCC BAA-1160 / DSM 100696 / MI-1)
Q60BT7 5.8e-19 83 32 4 195 3 MCA0378 dTTP/UTP pyrophosphatase Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q24SM2 6.83e-19 84 33 4 189 3 DSY3181 dTTP/UTP pyrophosphatase Desulfitobacterium hafniense (strain Y51)
Q5Z154 7.71e-19 83 33 4 185 3 NFA_9920 Nucleoside triphosphate pyrophosphatase Nocardia farcinica (strain IFM 10152)
A0PRJ3 1.01e-18 83 33 7 209 3 MUL_2634 Nucleoside triphosphate pyrophosphatase Mycobacterium ulcerans (strain Agy99)
Q0VS67 1.21e-18 82 34 5 184 3 ABO_0533 dTTP/UTP pyrophosphatase Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q1GZF7 1.26e-18 82 32 4 190 3 Mfla_2113 dTTP/UTP pyrophosphatase Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q7V6H8 1.37e-18 82 34 3 184 3 PMT_1181 Nucleoside triphosphate pyrophosphatase Prochlorococcus marinus (strain MIT 9313)
Q8RFE6 1.39e-18 82 28 4 189 3 FN0759 dTTP/UTP pyrophosphatase Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q3AWW1 1.5e-18 82 32 3 183 3 Syncc9902_1594 Nucleoside triphosphate pyrophosphatase Synechococcus sp. (strain CC9902)
Q07WQ2 1.66e-18 82 35 6 194 3 Sfri_3735 dTTP/UTP pyrophosphatase Shewanella frigidimarina (strain NCIMB 400)
A8FFU1 1.75e-18 82 31 4 196 3 maf dTTP/UTP pyrophosphatase Bacillus pumilus (strain SAFR-032)
C1FVY3 1.91e-18 82 30 5 196 3 CLM_3400 dTTP/UTP pyrophosphatase Clostridium botulinum (strain Kyoto / Type A2)
A2C7X9 2.3e-18 81 34 3 185 3 P9303_08381 Nucleoside triphosphate pyrophosphatase Prochlorococcus marinus (strain MIT 9303)
Q9KUU7 2.33e-18 81 32 3 182 3 VC_0418 dTTP/UTP pyrophosphatase Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q1IV55 2.82e-18 81 30 3 189 3 Acid345_0240 dTTP/UTP pyrophosphatase Koribacter versatilis (strain Ellin345)
Q28VZ8 3.36e-18 81 31 5 202 3 Jann_0197 Nucleoside triphosphate pyrophosphatase 1 Jannaschia sp. (strain CCS1)
Q0ABM5 3.61e-18 81 30 4 187 3 Mlg_0408 dTTP/UTP pyrophosphatase Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q48E97 3.89e-18 81 33 3 187 3 PSPPH_4169 dTTP/UTP pyrophosphatase Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q2YC50 4.42e-18 81 32 5 195 3 Nmul_A0363 dTTP/UTP pyrophosphatase Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B1IM03 4.92e-18 81 30 5 196 3 CLD_1540 dTTP/UTP pyrophosphatase Clostridium botulinum (strain Okra / Type B1)
Q8U476 5.41e-18 80 29 5 196 3 PF0216 dTTP/UTP pyrophosphatase Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
C3L3L1 6.96e-18 80 30 5 196 3 CLJ_B3262 dTTP/UTP pyrophosphatase Clostridium botulinum (strain 657 / Type Ba4)
Q4KIA3 7.37e-18 80 32 4 190 3 PFL_0899 dTTP/UTP pyrophosphatase Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
C0ZWV2 9.02e-18 80 30 5 196 3 RER_21290 Nucleoside triphosphate pyrophosphatase Rhodococcus erythropolis (strain PR4 / NBRC 100887)
Q8XIH4 9.64e-18 80 31 3 185 3 maf dTTP/UTP pyrophosphatase Clostridium perfringens (strain 13 / Type A)
Q7W7U4 1.11e-17 80 33 5 195 3 BPP2416 dTTP/UTP pyrophosphatase Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WL84 1.11e-17 80 33 5 195 3 BB1865 dTTP/UTP pyrophosphatase Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q11VI6 1.22e-17 80 32 7 191 3 CHU_1308 dTTP/UTP pyrophosphatase Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
C3PEA3 1.25e-17 80 33 6 199 3 cauri_0560 Nucleoside triphosphate pyrophosphatase Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CIP 107346 / CN-1)
Q0SR36 1.29e-17 80 30 3 185 3 CPR_2112 dTTP/UTP pyrophosphatase Clostridium perfringens (strain SM101 / Type A)
Q9HVU3 1.47e-17 80 32 4 193 3 PA4478 dTTP/UTP pyrophosphatase Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
B1KZT1 1.87e-17 79 30 5 196 3 CLK_2388 dTTP/UTP pyrophosphatase Clostridium botulinum (strain Loch Maree / Type A3)
A4SE83 2.07e-17 79 30 2 181 3 Cvib_0777 dTTP/UTP pyrophosphatase Chlorobium phaeovibrioides (strain DSM 265 / 1930)
Q9JVK3 2.31e-17 79 29 3 196 3 NMA0802 dTTP/UTP pyrophosphatase Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
Q73UG7 2.47e-17 79 31 5 188 3 MAP_3401 Nucleoside triphosphate pyrophosphatase Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10)
Q5WEQ9 2.59e-17 79 27 2 184 3 maf dTTP/UTP pyrophosphatase Shouchella clausii (strain KSM-K16)
A1T5Q3 2.67e-17 79 33 6 203 3 Mvan_1674 Nucleoside triphosphate pyrophosphatase Mycolicibacterium vanbaalenii (strain DSM 7251 / JCM 13017 / BCRC 16820 / KCTC 9966 / NRRL B-24157 / PYR-1)
B1I4S1 3.09e-17 79 33 2 169 3 Daud_1468 Nucleoside triphosphate pyrophosphatase Desulforudis audaxviator (strain MP104C)
Q87WS4 3.1e-17 79 33 3 191 3 maf-2 dTTP/UTP pyrophosphatase Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A7GHM0 3.36e-17 79 30 5 196 3 CLI_3058 dTTP/UTP pyrophosphatase Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
Q0TNG7 3.74e-17 78 30 3 185 3 CPF_2400 dTTP/UTP pyrophosphatase Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
Q8A749 4.19e-17 78 33 8 183 3 BT_1676 dTTP/UTP pyrophosphatase Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q1QVC0 4.43e-17 78 31 4 189 3 Csal_2237 dTTP/UTP pyrophosphatase Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B2TK54 4.77e-17 78 30 5 190 3 CLL_A0561 dTTP/UTP pyrophosphatase Clostridium botulinum (strain Eklund 17B / Type B)
Q2RN87 4.95e-17 78 30 3 172 3 Rru_A3614 Nucleoside triphosphate pyrophosphatase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
A5I684 5.38e-17 78 29 5 196 3 CBO3004 dTTP/UTP pyrophosphatase Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
A7FXW4 5.38e-17 78 29 5 196 3 CLB_3029 dTTP/UTP pyrophosphatase Clostridium botulinum (strain ATCC 19397 / Type A)
Q7NH22 6.26e-17 78 32 2 166 3 glr2715 dTTP/UTP pyrophosphatase Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Q6LMA4 6.84e-17 78 29 4 196 3 PBPRA3267 dTTP/UTP pyrophosphatase Photobacterium profundum (strain SS9)
Q7VWE3 7.61e-17 78 32 5 195 3 BP2314 dTTP/UTP pyrophosphatase Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q38YR2 9.16e-17 77 30 2 181 3 LCA_0364 dTTP/UTP pyrophosphatase Latilactobacillus sakei subsp. sakei (strain 23K)
Q5JI98 9.73e-17 77 31 5 190 3 TK0954 dTTP/UTP pyrophosphatase Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1)
Q7N035 1.06e-16 77 32 4 188 3 plu4068 dTTP/UTP pyrophosphatase Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
Q6DAI3 1.42e-16 77 32 5 198 3 ECA0270 dTTP/UTP pyrophosphatase Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q3SWH0 2.18e-16 77 31 4 172 3 Nwi_0103 Nucleoside triphosphate pyrophosphatase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q8FY22 2.46e-16 76 32 4 177 3 maf-2 7-methyl-GTP pyrophosphatase Brucella suis biovar 1 (strain 1330)
Q11LY4 2.94e-16 76 31 4 194 3 Meso_0186 dTTP/UTP pyrophosphatase Chelativorans sp. (strain BNC1)
Q8PIX4 3.11e-16 76 33 5 191 3 XAC2771 dTTP/UTP pyrophosphatase Xanthomonas axonopodis pv. citri (strain 306)
Q7P1T8 3.24e-16 76 29 3 192 3 CV_0124 dTTP/UTP pyrophosphatase Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
Q57AJ0 3.33e-16 76 32 4 177 3 BruAb1_2043 7-methyl-GTP pyrophosphatase Brucella abortus biovar 1 (strain 9-941)
Q2YR05 3.33e-16 76 32 4 177 3 BAB1_2069 7-methyl-GTP pyrophosphatase Brucella abortus (strain 2308)
Q8YE19 3.74e-16 76 32 4 177 3 BMEI2059 7-methyl-GTP pyrophosphatase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q72EP2 3.76e-16 76 31 5 196 3 DVU_0527 dTTP/UTP pyrophosphatase Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q3BRF4 4.12e-16 75 33 5 191 3 XCV2928 dTTP/UTP pyrophosphatase Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q89WP0 4.67e-16 75 31 4 172 3 blr0638 Nucleoside triphosphate pyrophosphatase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q6MQJ7 4.81e-16 75 29 3 187 3 Bd0469 dTTP/UTP pyrophosphatase Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
Q7V0U3 4.9e-16 76 29 4 208 3 PMM1159 Nucleoside triphosphate pyrophosphatase Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / NIES-2087 / MED4)
A5N6I4 5.07e-16 75 29 5 195 3 CKL_0864 dTTP/UTP pyrophosphatase Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9E003 5.07e-16 75 29 5 195 3 CKR_0777 dTTP/UTP pyrophosphatase Clostridium kluyveri (strain NBRC 12016)
Q035Z4 5.27e-16 75 32 5 185 3 LSEI_2233 dTTP/UTP pyrophosphatase Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
Q6G1B6 5.34e-16 75 31 5 180 3 BQ00020 7-methyl-GTP pyrophosphatase Bartonella quintana (strain Toulouse)
Q5QWE2 5.57e-16 75 31 4 187 3 IL0384 dTTP/UTP pyrophosphatase Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q0IBR4 6.15e-16 75 31 3 193 3 sync_0895 Nucleoside triphosphate pyrophosphatase Synechococcus sp. (strain CC9311)
Q6G5B0 7e-16 75 31 7 184 3 BH00020 7-methyl-GTP pyrophosphatase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q5FA52 7.24e-16 75 28 3 198 3 NGO0180 dTTP/UTP pyrophosphatase Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q1MNF5 7.36e-16 75 30 5 176 3 RL0002 7-methyl-GTP pyrophosphatase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
B9KXM8 7.98e-16 75 31 5 196 3 trd_0215 dTTP/UTP pyrophosphatase Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2)
B3W9W2 8.01e-16 75 31 5 185 3 LCABL_24150 dTTP/UTP pyrophosphatase Lacticaseibacillus casei (strain BL23)
Q5LLN0 8.97e-16 75 28 5 183 3 SPO3892 Nucleoside triphosphate pyrophosphatase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q2J353 1.23e-15 75 31 4 172 3 RPB_0396 Nucleoside triphosphate pyrophosphatase Rhodopseudomonas palustris (strain HaA2)
Q8KDS1 1.33e-15 74 31 4 183 3 maf dTTP/UTP pyrophosphatase Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS)
Q9K0J8 1.38e-15 74 28 3 196 3 NMB0598 dTTP/UTP pyrophosphatase Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
Q5FS71 1.41e-15 75 34 6 187 3 GOX1003 dTTP/UTP pyrophosphatase Gluconobacter oxydans (strain 621H)
Q7VKR7 1.63e-15 74 34 3 186 3 HD_1805 Nucleoside triphosphate pyrophosphatase Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B3QNY9 1.75e-15 74 31 4 183 3 Cpar_1237 dTTP/UTP pyrophosphatase Chlorobaculum parvum (strain DSM 263 / NCIMB 8327)
Q2GC58 2e-15 74 29 4 196 3 Saro_0116 Nucleoside triphosphate pyrophosphatase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q0BWA0 2.1e-15 74 31 4 174 3 GbCGDNIH1_0004 Nucleoside triphosphate pyrophosphatase Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
B2V089 3.3e-15 73 28 5 190 3 CLH_0546 dTTP/UTP pyrophosphatase Clostridium botulinum (strain Alaska E43 / Type E3)
Q8UHX5 3.77e-15 73 32 4 194 3 maf1 dTTP/UTP pyrophosphatase Agrobacterium fabrum (strain C58 / ATCC 33970)
Q6AGN3 4.1e-15 73 30 4 200 3 Lxx04750 Nucleoside triphosphate pyrophosphatase Leifsonia xyli subsp. xyli (strain CTCB07)
Q0AKD7 4.49e-15 73 30 5 196 3 Mmar10_2975 Nucleoside triphosphate pyrophosphatase Maricaulis maris (strain MCS10)
Q1GRU5 4.74e-15 73 31 4 189 3 Sala_1915 dTTP/UTP pyrophosphatase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q97JN3 5.21e-15 73 28 5 201 3 CA_C1240 dTTP/UTP pyrophosphatase Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q5GXK1 5.84e-15 72 32 5 191 3 XOO3316 dTTP/UTP pyrophosphatase Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P0P1 5.84e-15 72 32 5 191 3 XOO3131 dTTP/UTP pyrophosphatase Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q82XC7 6.26e-15 73 30 5 198 3 NE0356 dTTP/UTP pyrophosphatase Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A5EAG4 9.3e-15 72 32 5 197 3 BBta_0900 dTTP/UTP pyrophosphatase Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
Q9CLG6 1.17e-14 72 28 3 188 3 PM1268 dTTP/UTP pyrophosphatase Pasteurella multocida (strain Pm70)
Q2KYV3 1.24e-14 72 31 5 196 3 BAV2213 dTTP/UTP pyrophosphatase Bordetella avium (strain 197N)
Q8G2R6 1.41e-14 72 33 4 193 3 maf-1 dTTP/UTP pyrophosphatase Brucella suis biovar 1 (strain 1330)
Q8YF55 1.41e-14 72 33 4 193 3 BMEI1672 dTTP/UTP pyrophosphatase Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
Q57FA3 1.41e-14 72 33 4 193 3 BruAb1_0276 dTTP/UTP pyrophosphatase Brucella abortus biovar 1 (strain 9-941)
Q2YPC2 1.41e-14 72 33 4 193 3 BAB1_0281 dTTP/UTP pyrophosphatase Brucella abortus (strain 2308)
A6LQP7 1.43e-14 71 29 5 187 3 Cbei_0489 dTTP/UTP pyrophosphatase Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
Q73K74 1.63e-14 72 28 5 207 3 TDE_2348 dTTP/UTP pyrophosphatase Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
O59604 2.23e-14 71 26 5 191 3 PH1941 dTTP/UTP pyrophosphatase Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
B9KIX1 2.29e-14 71 31 3 175 3 AMF_588 Nucleoside triphosphate pyrophosphatase Anaplasma marginale (strain Florida)
Q8G4U8 2.66e-14 73 36 2 126 3 BL1276 Nucleoside triphosphate pyrophosphatase/Nudix hydrolase fusion protein Bifidobacterium longum (strain NCC 2705)
Q82I23 3.06e-14 71 30 2 196 3 SAV_3335 Nucleoside triphosphate pyrophosphatase Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680)
Q13E26 3.17e-14 71 31 4 177 3 RPD_0425 Nucleoside triphosphate pyrophosphatase Rhodopseudomonas palustris (strain BisB5)
Q2GKV0 3.32e-14 70 33 3 178 3 APH_0396 Nucleoside triphosphate pyrophosphatase Anaplasma phagocytophilum (strain HZ)
Q11CM5 4.19e-14 70 30 5 186 3 Meso_3479 7-methyl-GTP pyrophosphatase Chelativorans sp. (strain BNC1)
Q7UWY8 4.31e-14 71 30 3 195 3 RB1703 dTTP/UTP pyrophosphatase Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)
Q82ZA4 4.78e-14 70 32 2 183 3 maf dTTP/UTP pyrophosphatase Enterococcus faecalis (strain ATCC 700802 / V583)
Q5HB21 5.2e-14 70 30 4 191 3 Erum5100 Nucleoside triphosphate pyrophosphatase Ehrlichia ruminantium (strain Welgevonden)
Q2KEA0 5.48e-14 70 30 5 176 3 RHE_CH00002 7-methyl-GTP pyrophosphatase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q7MWG0 5.65e-14 70 34 5 179 3 maf dTTP/UTP pyrophosphatase Porphyromonas gingivalis (strain ATCC BAA-308 / W83)
Q9PK45 6.59e-14 70 30 4 185 3 TC_0628 Nucleoside triphosphate pyrophosphatase Chlamydia muridarum (strain MoPn / Nigg)
A3DMH6 7.17e-14 70 31 5 183 3 Smar_0734 dTTP/UTP pyrophosphatase Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1)
B2RIL9 8.37e-14 70 34 5 179 3 PGN_0695 dTTP/UTP pyrophosphatase Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / CIP 103683 / JCM 12257 / NCTC 11834 / 2561)
Q5GT91 9.6e-14 69 30 2 176 3 Wbm0192 dTTP/UTP pyrophosphatase Wolbachia sp. subsp. Brugia malayi (strain TRS)
Q5PAF5 9.97e-14 69 31 3 175 3 AM793 Nucleoside triphosphate pyrophosphatase Anaplasma marginale (strain St. Maries)
Q3IFH5 1.03e-13 69 33 3 183 3 PSHAa2679 dTTP/UTP pyrophosphatase Pseudoalteromonas translucida (strain TAC 125)
Q9PEA4 1.18e-13 69 32 3 184 3 XF_1124 Nucleoside triphosphate pyrophosphatase Xylella fastidiosa (strain 9a5c)
Q5NRI7 1.61e-13 69 30 6 178 3 ZMO0043 Nucleoside triphosphate pyrophosphatase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q4FNS4 2.06e-13 68 28 8 200 3 SAR11_0342 Nucleoside triphosphate pyrophosphatase Pelagibacter ubique (strain HTCC1062)
B6YWV3 2.15e-13 68 29 4 174 3 TON_1078 dTTP/UTP pyrophosphatase Thermococcus onnurineus (strain NA1)
Q9EWV6 2.31e-13 68 29 1 171 3 SCO4923 Nucleoside triphosphate pyrophosphatase Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)
Q49670 2.35e-13 68 32 9 207 3 ML0729 Nucleoside triphosphate pyrophosphatase Mycobacterium leprae (strain TN)
B8ZUX8 2.35e-13 68 32 9 207 3 MLBr00729 Nucleoside triphosphate pyrophosphatase Mycobacterium leprae (strain Br4923)
C0R2U8 2.46e-13 68 29 2 176 3 WRi_004530 dTTP/UTP pyrophosphatase Wolbachia sp. subsp. Drosophila simulans (strain wRi)
Q5FGZ7 2.93e-13 68 30 3 185 3 ERGA_CDS_05250 Nucleoside triphosphate pyrophosphatase Ehrlichia ruminantium (strain Gardel)
Q92TF1 3.66e-13 68 31 6 194 3 R00002 7-methyl-GTP pyrophosphatase Rhizobium meliloti (strain 1021)
O84353 4.32e-13 68 30 4 185 3 CT_349 dTTP/UTP pyrophosphatase Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q3KM09 4.32e-13 68 30 4 185 3 CTA_0378 dTTP/UTP pyrophosphatase Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
B0BBY3 4.41e-13 68 30 4 185 3 CTLon_0601 dTTP/UTP pyrophosphatase Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
B0B7R8 4.41e-13 68 30 4 185 3 CTL0603 dTTP/UTP pyrophosphatase Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
Q1QRY3 4.77e-13 68 30 4 173 3 Nham_0113 Nucleoside triphosphate pyrophosphatase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q73I47 4.85e-13 67 29 2 176 3 WD_0333 dTTP/UTP pyrophosphatase Wolbachia pipientis wMel
A4FNQ1 5.67e-13 67 28 4 201 3 SACE_6507 Nucleoside triphosphate pyrophosphatase Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338)
Q3ALJ5 5.75e-13 67 32 3 182 3 Syncc9605_0768 Nucleoside triphosphate pyrophosphatase Synechococcus sp. (strain CC9605)
Q9A5V5 5.95e-13 67 31 3 190 3 CC_2342 dTTP/UTP pyrophosphatase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q92S22 6e-13 67 30 5 197 3 R00615 dTTP/UTP pyrophosphatase Rhizobium meliloti (strain 1021)
B3CL80 6.26e-13 67 29 2 176 3 WP0036 dTTP/UTP pyrophosphatase Wolbachia pipientis subsp. Culex pipiens (strain wPip)
Q87EA3 6.35e-13 67 31 3 184 3 PD_0415 Nucleoside triphosphate pyrophosphatase Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B2I858 6.35e-13 67 31 3 184 3 XfasM23_0408 Nucleoside triphosphate pyrophosphatase Xylella fastidiosa (strain M23)
Q253S7 6.79e-13 67 30 7 193 3 CF0689 dTTP/UTP pyrophosphatase Chlamydia felis (strain Fe/C-56)
Q1GP76 8.28e-13 67 28 6 205 3 Sala_2841 Nucleoside triphosphate pyrophosphatase Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q5LAQ8 9.17e-13 67 31 6 189 3 BF3120 dTTP/UTP pyrophosphatase Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / LMG 10263 / NCTC 9343 / Onslow / VPI 2553 / EN-2)
A4TF31 1.21e-12 67 27 4 203 3 Mflv_4776 Nucleoside triphosphate pyrophosphatase Mycolicibacterium gilvum (strain PYR-GCK)
Q989F1 1.45e-12 66 32 5 194 3 mll6452 dTTP/UTP pyrophosphatase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q5LLE9 1.6e-12 66 28 4 193 3 SPOA0078 dTTP/UTP pyrophosphatase Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q5E7X6 1.66e-12 66 29 3 188 3 VF_0375 dTTP/UTP pyrophosphatase Aliivibrio fischeri (strain ATCC 700601 / ES114)
A2C3V6 1.71e-12 66 29 5 211 3 NATL1_16091 Nucleoside triphosphate pyrophosphatase Prochlorococcus marinus (strain NATL1A)
Q64R56 2.09e-12 66 30 6 189 3 BF3281 dTTP/UTP pyrophosphatase Bacteroides fragilis (strain YCH46)
Q1GLE1 2.15e-12 66 30 4 189 3 TM1040_3556 dTTP/UTP pyrophosphatase Ruegeria sp. (strain TM1040)
Q46JR8 2.21e-12 66 28 4 211 3 PMN2A_0769 Nucleoside triphosphate pyrophosphatase Prochlorococcus marinus (strain NATL2A)
A5FQJ4 2.53e-12 66 25 1 188 3 DehaBAV1_0949 dTTP/UTP pyrophosphatase Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
Q823U1 2.69e-12 65 30 7 193 3 CCA_00314 dTTP/UTP pyrophosphatase Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
Q1BCI0 3.45e-12 65 30 5 191 3 Mmcs_1292 Nucleoside triphosphate pyrophosphatase Mycobacterium sp. (strain MCS)
A1UCG3 3.45e-12 65 30 5 191 3 Mkms_1309 Nucleoside triphosphate pyrophosphatase Mycobacterium sp. (strain KMS)
A3PW53 3.45e-12 65 30 5 191 3 Mjls_1328 Nucleoside triphosphate pyrophosphatase Mycobacterium sp. (strain JLS)
Q169N3 3.9e-12 65 29 4 188 3 RD1_1686 dTTP/UTP pyrophosphatase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q8FA20 3.96e-12 65 28 2 148 3 LA_0017 dTTP/UTP pyrophosphatase Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72WC1 3.96e-12 65 28 2 148 3 LIC_10016 dTTP/UTP pyrophosphatase Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q1LQB1 7.37e-12 64 30 6 198 3 Rmet_0779 dTTP/UTP pyrophosphatase Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q20Y49 8.18e-12 64 31 6 197 3 RPC_4414 dTTP/UTP pyrophosphatase Rhodopseudomonas palustris (strain BisB18)
Q2KCN4 9.69e-12 64 31 4 194 3 RHE_CH00585 dTTP/UTP pyrophosphatase Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
Q315F5 1.08e-11 64 26 3 172 3 Dde_0640 dTTP/UTP pyrophosphatase Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
Q8P7K1 1.13e-11 63 28 3 191 3 XCC2610 dTTP/UTP pyrophosphatase Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
Q4UWJ9 1.13e-11 63 28 3 191 3 XC_1506 dTTP/UTP pyrophosphatase Xanthomonas campestris pv. campestris (strain 8004)
C5A216 1.3e-11 63 30 5 176 3 TGAM_1933 dTTP/UTP pyrophosphatase Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3)
Q1MQH1 1.36e-11 64 27 3 194 3 LI0702 dTTP/UTP pyrophosphatase Lawsonia intracellularis (strain PHE/MN1-00)
Q0C6A7 1.36e-11 63 30 5 174 3 HNE_0002 Nucleoside triphosphate pyrophosphatase Hyphomonas neptunium (strain ATCC 15444)
Q1QRF9 1.42e-11 63 31 5 199 3 Nham_0292 dTTP/UTP pyrophosphatase Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
A5CCC1 1.53e-11 63 27 6 199 3 OTBS_0250 Nucleoside triphosphate pyrophosphatase Orientia tsutsugamushi (strain Boryong)
Q3ZY38 1.58e-11 64 25 1 188 3 cbdbA1046 dTTP/UTP pyrophosphatase Dehalococcoides mccartyi (strain CBDB1)
Q6G253 1.63e-11 64 29 4 202 3 BH14130 dTTP/UTP pyrophosphatase Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
Q9ZCE2 1.67e-11 64 29 5 191 3 RP815 Nucleoside triphosphate pyrophosphatase Rickettsia prowazekii (strain Madrid E)
Q5FS37 1.71e-11 63 31 5 173 3 GOX1038 Nucleoside triphosphate pyrophosphatase Gluconobacter oxydans (strain 621H)
Q130J6 2.27e-11 63 31 6 198 3 RPD_4276 dTTP/UTP pyrophosphatase Rhodopseudomonas palustris (strain BisB5)
Q1GCM3 2.63e-11 63 27 5 189 3 TM1040_2861 Nucleoside triphosphate pyrophosphatase Ruegeria sp. (strain TM1040)
Q9AC58 3.09e-11 63 28 6 189 3 CC_0002 Nucleoside triphosphate pyrophosphatase Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
Q4UJZ5 3.56e-11 62 29 5 191 3 RF_1293 Nucleoside triphosphate pyrophosphatase Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
A8GQ13 3.67e-11 62 29 5 192 3 A1C_06305 Nucleoside triphosphate pyrophosphatase Rickettsia akari (strain Hartford)
B1YJT1 4.03e-11 62 29 6 196 3 Exig_2117 dTTP/UTP pyrophosphatase Exiguobacterium sibiricum (strain DSM 17290 / CCUG 55495 / CIP 109462 / JCM 13490 / 255-15)
Q68VT4 4.69e-11 63 29 5 191 3 RT0803 Nucleoside triphosphate pyrophosphatase Rickettsia typhi (strain ATCC VR-144 / Wilmington)
A8GTV6 4.94e-11 62 29 5 191 3 A1G_06950 Nucleoside triphosphate pyrophosphatase Rickettsia rickettsii (strain Sheila Smith)
B0BVE4 4.94e-11 62 29 5 191 3 RrIowa_1484 Nucleoside triphosphate pyrophosphatase Rickettsia rickettsii (strain Iowa)
C4K258 4.94e-11 62 29 5 191 3 RPR_05215 Nucleoside triphosphate pyrophosphatase Rickettsia peacockii (strain Rustic)
Q6G132 5.4e-11 62 30 4 202 3 BQ11190 dTTP/UTP pyrophosphatase Bartonella quintana (strain Toulouse)
Q1MLP2 6.55e-11 62 31 4 194 3 RL0617 dTTP/UTP pyrophosphatase Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q3Z7G4 7.95e-11 62 25 1 188 3 DET1120 dTTP/UTP pyrophosphatase Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q5L6G5 8.02e-11 62 29 5 188 3 CAB310 dTTP/UTP pyrophosphatase Chlamydia abortus (strain DSM 27085 / S26/3)
Q2VYH3 8.88e-11 61 28 7 203 3 amb4548 Nucleoside triphosphate pyrophosphatase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q6N181 8.92e-11 62 31 6 197 3 RPA4527 dTTP/UTP pyrophosphatase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q3AQS4 9.93e-11 61 27 4 182 3 Cag_1393 dTTP/UTP pyrophosphatase Chlorobium chlorochromatii (strain CaD3)
Q5NNS3 1.21e-10 61 28 3 188 3 ZMO1013 dTTP/UTP pyrophosphatase Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
Q3B3P0 1.21e-10 61 32 5 181 3 Plut_1179 dTTP/UTP pyrophosphatase Chlorobium luteolum (strain DSM 273 / BCRC 81028 / 2530)
B2KC30 1.46e-10 60 27 6 198 3 Emin_0602 dTTP/UTP pyrophosphatase Elusimicrobium minutum (strain Pei191)
Q2RQN0 1.49e-10 61 30 4 193 3 Rru_A2768 dTTP/UTP pyrophosphatase Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q92G57 1.73e-10 61 29 5 191 3 RC1266 Nucleoside triphosphate pyrophosphatase Rickettsia conorii (strain ATCC VR-613 / Malish 7)
Q3SVZ7 1.94e-10 60 30 5 199 3 Nwi_0277 dTTP/UTP pyrophosphatase Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A6L8E5 2.47e-10 60 30 7 185 3 BDI_0169 dTTP/UTP pyrophosphatase Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)
Q2GGV6 5.26e-10 59 27 3 185 3 ECH_0512 Nucleoside triphosphate pyrophosphatase Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
Q54TC5 5.94e-10 59 25 3 193 3 DDB_G0281937 7-methyl-GTP pyrophosphatase Dictyostelium discoideum
Q1RK90 7.1e-10 59 29 5 192 3 RBE_0143 Nucleoside triphosphate pyrophosphatase Rickettsia bellii (strain RML369-C)
A8GXY9 7.1e-10 59 29 5 192 3 A1I_07195 Nucleoside triphosphate pyrophosphatase Rickettsia bellii (strain OSU 85-389)
Q04XA6 7.57e-10 58 29 2 148 3 LBL_2976 dTTP/UTP pyrophosphatase Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04NX0 7.57e-10 58 29 2 148 3 LBJ_3012 dTTP/UTP pyrophosphatase Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q3YRV1 8.05e-10 58 27 3 176 3 Ecaj_0518 Nucleoside triphosphate pyrophosphatase Ehrlichia canis (strain Jake)
Q39E95 1.67e-09 58 26 5 191 3 Bcep18194_A5627 dTTP/UTP pyrophosphatase Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A8F031 1.74e-09 58 30 5 191 3 A1E_05240 Nucleoside triphosphate pyrophosphatase Rickettsia canadensis (strain McKiel)
Q21FT3 1.76e-09 58 28 4 185 3 Sde_3189 dTTP/UTP pyrophosphatase Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q8UJC6 2.71e-09 57 25 3 172 3 maf2 Nucleoside triphosphate pyrophosphatase Agrobacterium fabrum (strain C58 / ATCC 33970)
C1AH56 2.94e-09 57 27 4 206 3 JTY_3307 Nucleoside triphosphate pyrophosphatase Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019)
A1KNT4 2.94e-09 57 27 4 206 3 BCG_3311 Nucleoside triphosphate pyrophosphatase Mycobacterium bovis (strain BCG / Pasteur 1173P2)
Q7TWT7 2.94e-09 57 27 4 206 3 BQ2027_MB3310 Nucleoside triphosphate pyrophosphatase Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)
A6GZH5 3.09e-09 57 28 4 176 3 FP1422 dTTP/UTP pyrophosphatase Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q1BUW3 3.51e-09 57 27 5 196 3 Bcen_1688 dTTP/UTP pyrophosphatase Burkholderia orbicola (strain AU 1054)
P9WK27 3.93e-09 57 27 4 206 1 Rv3282 Nucleoside triphosphate pyrophosphatase Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
P9WK26 3.93e-09 57 27 4 206 3 MT3381 Nucleoside triphosphate pyrophosphatase Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
A5U7V6 3.93e-09 57 27 4 206 3 MRA_3323 Nucleoside triphosphate pyrophosphatase Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra)
Q46Y94 5.02e-09 57 30 6 195 3 Reut_A2528 dTTP/UTP pyrophosphatase Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q3IYH0 7.01e-09 56 29 5 181 3 RHOS4_28460 Nucleoside triphosphate pyrophosphatase Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
Q89V00 7.63e-09 56 28 6 204 3 blr1259 dTTP/UTP pyrophosphatase Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
Q6ND10 8.84e-09 56 30 5 177 3 RPA0299 Nucleoside triphosphate pyrophosphatase Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q3SG65 9.79e-09 56 30 6 199 3 Tbd_2438 dTTP/UTP pyrophosphatase Thiobacillus denitrificans (strain ATCC 25259)
Q98DY4 1.36e-08 55 26 5 176 3 mlr4491 7-methyl-GTP pyrophosphatase Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
O95671 1.74e-08 57 26 6 203 1 ASMTL Probable bifunctional dTTP/UTP pyrophosphatase/methyltransferase protein Homo sapiens
Q142M3 2.21e-08 55 27 3 190 3 Bxeno_A1178 dTTP/UTP pyrophosphatase Paraburkholderia xenovorans (strain LB400)
Q2SZT6 4.18e-08 54 28 6 197 3 BTH_I1009 dTTP/UTP pyrophosphatase Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q2GCP9 4.35e-08 54 29 5 188 3 NSE_0881 Nucleoside triphosphate pyrophosphatase Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
Q2IRX7 5.14e-08 54 29 7 204 3 RPB_4346 dTTP/UTP pyrophosphatase Rhodopseudomonas palustris (strain HaA2)
Q0C2H1 8.67e-08 53 29 4 188 3 HNE_1355 dTTP/UTP pyrophosphatase Hyphomonas neptunium (strain ATCC 15444)
C3PLU6 1.4e-07 53 29 5 191 3 RAF_ORF1157 Nucleoside triphosphate pyrophosphatase Rickettsia africae (strain ESF-5)
Q63VT5 2.87e-07 52 27 6 194 3 BPSL1159 dTTP/UTP pyrophosphatase Burkholderia pseudomallei (strain K96243)
Q3JUG5 2.87e-07 52 27 6 194 3 BURPS1710b_1378 dTTP/UTP pyrophosphatase Burkholderia pseudomallei (strain 1710b)
Q62II4 2.87e-07 52 27 6 194 3 BMA1890 dTTP/UTP pyrophosphatase Burkholderia mallei (strain ATCC 23344)
Q2W1Y3 3.09e-07 52 28 3 192 3 amb3338 dTTP/UTP pyrophosphatase Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
P58634 4.93e-07 51 27 4 201 3 RSc2196 dTTP/UTP pyrophosphatase Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
A5FFP4 5.63e-07 51 24 5 192 3 Fjoh_2955 dTTP/UTP pyrophosphatase Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
Q16CZ1 8.38e-07 50 24 5 185 3 RD1_0437 Nucleoside triphosphate pyrophosphatase Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q28NC5 1.35e-06 50 26 5 190 3 Jann_2870 Nucleoside triphosphate pyrophosphatase 2 Jannaschia sp. (strain CCS1)
Q0BTC5 3.43e-06 49 29 6 204 3 GbCGDNIH1_1029 dTTP/UTP pyrophosphatase Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q1QDI9 7.5e-06 48 24 6 218 3 Pcryo_0481 dTTP/UTP pyrophosphatase Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q12C38 2.53e-05 46 27 5 195 3 Bpro_1974 dTTP/UTP pyrophosphatase Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q2G9H1 3.26e-05 46 30 7 195 3 Saro_1057 dTTP/UTP pyrophosphatase Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q9Z9F9 3.65e-05 46 27 5 184 3 CPn_0022 Nucleoside triphosphate pyrophosphatase Chlamydia pneumoniae
Q55G28 0.00012 44 27 4 191 3 DDB_G0267852 Nucleoside triphosphate pyrophosphatase Dictyostelium discoideum
O14141 0.000147 44 26 8 203 1 SPAC3G6.03c dTTP/UTP pyrophosphatase Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Q4FUF9 0.000194 44 24 6 218 3 Psyc_0486 dTTP/UTP pyrophosphatase Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_16080
Feature type CDS
Gene maf
Product 7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily
Location 75428 - 76018 (strand: 1)
Length 591 (nucleotides) / 196 (amino acids)
In genomic island -

Contig

Accession ZDB_532
Length 116685 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2003
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF02545 Maf-like protein

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0424 Secondary metabolites biosynthesis, transport and catabolism (Q) Q 7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K25422 7-methyl-GTP pyrophosphatase [EC:3.6.1.-] - -

Protein Sequence

MISLVLASTSLYRKALLEKLGIPFVSAAPGTDETPHPAEDAQSLVMRLAREKARSLTQQYPDSLIIGSDQVCVLDGEITGKPHHYDAAFAQLRKASGQCITFYTGLTLYNSATGEDHTICEPYCVHFRTLDDDEIRAYLLAETPYQCAGSFKSEGLGIALFKKLQGDDPNTLIGLPLIRLTELLIQAGYNPLRIPR

Flanking regions ( +/- flanking 50bp)

GCATAGTTTAGAATGAGTTTATTCTTTTTACCACGACTTTCGGAATATTTATGATCTCATTGGTTCTCGCCTCCACCTCCCTGTACCGCAAAGCTTTGCTGGAAAAACTCGGCATCCCGTTTGTATCCGCCGCCCCGGGTACGGATGAAACCCCGCACCCGGCAGAAGATGCGCAGTCTCTGGTCATGCGCCTGGCACGCGAAAAAGCCCGTTCATTGACACAGCAGTACCCTGACAGCCTGATTATCGGCTCTGATCAGGTCTGTGTGCTGGACGGGGAAATCACCGGTAAGCCGCATCATTATGATGCCGCCTTTGCACAACTGCGCAAAGCTTCCGGTCAGTGCATCACCTTTTATACCGGGCTGACCCTGTACAACAGCGCCACAGGGGAAGATCACACGATATGTGAACCTTACTGTGTGCATTTCCGTACACTGGATGATGACGAAATTCGTGCCTATCTGCTGGCGGAAACGCCCTATCAGTGTGCCGGAAGCTTTAAATCTGAAGGTTTAGGAATCGCCTTATTTAAAAAACTTCAGGGAGATGACCCTAATACACTGATAGGTTTACCGCTGATCCGTCTGACAGAATTACTGATTCAGGCCGGATACAACCCACTGCGGATCCCCCGCTGACACACGCCGGGGCATCCGATGATTCTGAGGAACTGACATGAAGCTGAAAA