Homologs in group_2001

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_14735 FBDBKF_14735 100.0 Morganella morganii S1 rpmF 50S ribosomal protein L32
EHELCC_15540 EHELCC_15540 100.0 Morganella morganii S2 rpmF 50S ribosomal protein L32
LHKJJB_15770 LHKJJB_15770 100.0 Morganella morganii S3 rpmF 50S ribosomal protein L32
HKOGLL_14890 HKOGLL_14890 100.0 Morganella morganii S5 rpmF 50S ribosomal protein L32
F4V73_RS07530 F4V73_RS07530 98.2 Morganella psychrotolerans rpmF 50S ribosomal protein L32
PMI_RS04205 PMI_RS04205 96.4 Proteus mirabilis HI4320 rpmF 50S ribosomal protein L32

Distribution of the homologs in the orthogroup group_2001

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2001

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q7N382 1.37e-33 111 94 0 56 3 rpmF Large ribosomal subunit protein bL32 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
B4ETC5 1.38e-33 111 96 0 56 3 rpmF Large ribosomal subunit protein bL32 Proteus mirabilis (strain HI4320)
A7MFQ6 1.83e-30 103 89 1 57 3 rpmF Large ribosomal subunit protein bL32 Cronobacter sakazakii (strain ATCC BAA-894)
Q2NU44 1.93e-30 103 85 0 56 3 rpmF Large ribosomal subunit protein bL32 Sodalis glossinidius (strain morsitans)
C4K3Q5 2.87e-30 103 83 0 56 3 rpmF Large ribosomal subunit protein bL32 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
C6DKT7 4.4e-30 102 85 0 56 3 rpmF Large ribosomal subunit protein bL32 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D692 4.4e-30 102 85 0 56 3 rpmF Large ribosomal subunit protein bL32 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
B1JHI1 6.45e-30 102 87 0 54 3 rpmF Large ribosomal subunit protein bL32 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q669K9 6.45e-30 102 87 0 54 3 rpmF Large ribosomal subunit protein bL32 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TLS5 6.45e-30 102 87 0 54 3 rpmF Large ribosomal subunit protein bL32 Yersinia pestis (strain Pestoides F)
Q1CI17 6.45e-30 102 87 0 54 3 rpmF Large ribosomal subunit protein bL32 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R3Q0 6.45e-30 102 87 0 54 3 rpmF Large ribosomal subunit protein bL32 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZFT9 6.45e-30 102 87 0 54 3 rpmF Large ribosomal subunit protein bL32 Yersinia pestis
B2K760 6.45e-30 102 87 0 54 3 rpmF Large ribosomal subunit protein bL32 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1C6M6 6.45e-30 102 87 0 54 3 rpmF Large ribosomal subunit protein bL32 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FH23 6.45e-30 102 87 0 54 3 rpmF Large ribosomal subunit protein bL32 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JN60 6.45e-30 102 87 0 54 3 rpmF Large ribosomal subunit protein bL32 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q3Z328 2.03e-29 100 87 1 57 3 rpmF Large ribosomal subunit protein bL32 Shigella sonnei (strain Ss046)
P0A7N8 2.03e-29 100 87 1 57 3 rpmF Large ribosomal subunit protein bL32 Shigella flexneri
Q32EU9 2.03e-29 100 87 1 57 3 rpmF Large ribosomal subunit protein bL32 Shigella dysenteriae serotype 1 (strain Sd197)
Q31ZE4 2.03e-29 100 87 1 57 3 rpmF Large ribosomal subunit protein bL32 Shigella boydii serotype 4 (strain Sb227)
B2U532 2.03e-29 100 87 1 57 3 rpmF Large ribosomal subunit protein bL32 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P0A7N6 2.03e-29 100 87 1 57 3 rpmF Large ribosomal subunit protein bL32 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A7N7 2.03e-29 100 87 1 57 3 rpmF Large ribosomal subunit protein bL32 Salmonella typhi
B5BAI4 2.03e-29 100 87 1 57 3 rpmF Large ribosomal subunit protein bL32 Salmonella paratyphi A (strain AKU_12601)
Q5PGT9 2.03e-29 100 87 1 57 3 rpmF Large ribosomal subunit protein bL32 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B5RBB1 2.03e-29 100 87 1 57 3 rpmF Large ribosomal subunit protein bL32 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5QXE5 2.03e-29 100 87 1 57 3 rpmF Large ribosomal subunit protein bL32 Salmonella enteritidis PT4 (strain P125109)
Q57QG6 2.03e-29 100 87 1 57 3 rpmF Large ribosomal subunit protein bL32 Salmonella choleraesuis (strain SC-B67)
A9MGD1 2.03e-29 100 87 1 57 3 rpmF Large ribosomal subunit protein bL32 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
Q1RD68 2.03e-29 100 87 1 57 3 rpmF Large ribosomal subunit protein bL32 Escherichia coli (strain UTI89 / UPEC)
B1LI56 2.03e-29 100 87 1 57 3 rpmF Large ribosomal subunit protein bL32 Escherichia coli (strain SMS-3-5 / SECEC)
B6I9G6 2.03e-29 100 87 1 57 3 rpmF Large ribosomal subunit protein bL32 Escherichia coli (strain SE11)
B7NAW5 2.03e-29 100 87 1 57 3 rpmF Large ribosomal subunit protein bL32 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7N4 2.03e-29 100 87 1 57 1 rpmF Large ribosomal subunit protein bL32 Escherichia coli (strain K12)
B1IV14 2.03e-29 100 87 1 57 3 rpmF Large ribosomal subunit protein bL32 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
Q0TIY5 2.03e-29 100 87 1 57 3 rpmF Large ribosomal subunit protein bL32 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A7ZZ46 2.03e-29 100 87 1 57 3 rpmF Large ribosomal subunit protein bL32 Escherichia coli O9:H4 (strain HS)
B1X9Z9 2.03e-29 100 87 1 57 3 rpmF Large ribosomal subunit protein bL32 Escherichia coli (strain K12 / DH10B)
C4ZS29 2.03e-29 100 87 1 57 3 rpmF Large ribosomal subunit protein bL32 Escherichia coli (strain K12 / MC4100 / BW2952)
B7LX23 2.03e-29 100 87 1 57 3 rpmF Large ribosomal subunit protein bL32 Escherichia coli O8 (strain IAI1)
B7MTL9 2.03e-29 100 87 1 57 3 rpmF Large ribosomal subunit protein bL32 Escherichia coli O81 (strain ED1a)
B7NKJ1 2.03e-29 100 87 1 57 3 rpmF Large ribosomal subunit protein bL32 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YVV7 2.03e-29 100 87 1 57 3 rpmF Large ribosomal subunit protein bL32 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7N5 2.03e-29 100 87 1 57 3 rpmF Large ribosomal subunit protein bL32 Escherichia coli O157:H7
B7LG22 2.03e-29 100 87 1 57 3 rpmF Large ribosomal subunit protein bL32 Escherichia coli (strain 55989 / EAEC)
B7MJ76 2.03e-29 100 87 1 57 3 rpmF Large ribosomal subunit protein bL32 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UPA5 2.03e-29 100 87 1 57 3 rpmF Large ribosomal subunit protein bL32 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
B2VDK9 2.24e-29 100 83 0 56 3 rpmF Large ribosomal subunit protein bL32 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A8GD15 3.39e-29 100 85 0 54 3 rpmF Large ribosomal subunit protein bL32 Serratia proteamaculans (strain 568)
A6T7E9 4.74e-29 100 85 1 57 3 rpmF Large ribosomal subunit protein bL32 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XXI1 4.74e-29 100 85 1 57 3 rpmF Large ribosomal subunit protein bL32 Klebsiella pneumoniae (strain 342)
B7LT49 4.74e-29 100 85 1 57 3 rpmF Large ribosomal subunit protein bL32 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A4W9A3 1.06e-28 99 84 1 57 3 rpmF Large ribosomal subunit protein bL32 Enterobacter sp. (strain 638)
C5BA64 4.11e-28 97 83 0 56 3 rpmF Large ribosomal subunit protein bL32 Edwardsiella ictaluri (strain 93-146)
C3LNX6 6.46e-28 97 80 0 56 3 rpmF Large ribosomal subunit protein bL32 Vibrio cholerae serotype O1 (strain M66-2)
Q9KQH3 6.46e-28 97 80 0 56 3 rpmF Large ribosomal subunit protein bL32 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F6P1 6.46e-28 97 80 0 56 3 rpmF Large ribosomal subunit protein bL32 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
A1S733 1.09e-27 96 82 0 56 3 rpmF Large ribosomal subunit protein bL32 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q7MM02 1.21e-27 96 80 0 56 3 rpmF Large ribosomal subunit protein bL32 Vibrio vulnificus (strain YJ016)
Q8D8G4 1.21e-27 96 80 0 56 3 rpmF Large ribosomal subunit protein bL32 Vibrio vulnificus (strain CMCP6)
Q12LU9 2.19e-27 95 80 0 56 3 rpmF Large ribosomal subunit protein bL32 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
Q0HTV0 3.78e-27 95 78 0 56 3 rpmF Large ribosomal subunit protein bL32 Shewanella sp. (strain MR-7)
Q0HHJ6 3.78e-27 95 78 0 56 3 rpmF Large ribosomal subunit protein bL32 Shewanella sp. (strain MR-4)
A0KYC0 3.78e-27 95 78 0 56 3 rpmF Large ribosomal subunit protein bL32 Shewanella sp. (strain ANA-3)
Q8EDG9 3.78e-27 95 78 0 56 3 rpmF Large ribosomal subunit protein bL32 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A1RKS3 4.32e-27 95 78 0 56 3 rpmF Large ribosomal subunit protein bL32 Shewanella sp. (strain W3-18-1)
A4Y5S0 4.32e-27 95 78 0 56 3 rpmF Large ribosomal subunit protein bL32 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
A9KXI7 4.32e-27 95 78 0 56 3 rpmF Large ribosomal subunit protein bL32 Shewanella baltica (strain OS195)
A6WM16 4.32e-27 95 78 0 56 3 rpmF Large ribosomal subunit protein bL32 Shewanella baltica (strain OS185)
A3D3B1 4.32e-27 95 78 0 56 3 rpmF Large ribosomal subunit protein bL32 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8EF24 4.32e-27 95 78 0 56 3 rpmF Large ribosomal subunit protein bL32 Shewanella baltica (strain OS223)
Q084G9 7.24e-27 94 78 0 56 3 rpmF Large ribosomal subunit protein bL32 Shewanella frigidimarina (strain NCIMB 400)
B5FG43 7.65e-27 94 80 0 56 3 rpmF Large ribosomal subunit protein bL32 Aliivibrio fischeri (strain MJ11)
Q5E407 7.65e-27 94 80 0 56 3 rpmF Large ribosomal subunit protein bL32 Aliivibrio fischeri (strain ATCC 700601 / ES114)
Q1LT35 8.82e-27 94 73 0 56 3 rpmF Large ribosomal subunit protein bL32 Baumannia cicadellinicola subsp. Homalodisca coagulata
Q87N18 9.01e-27 94 78 0 56 3 rpmF Large ribosomal subunit protein bL32 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MZU8 9.01e-27 94 78 0 56 3 rpmF Large ribosomal subunit protein bL32 Vibrio campbellii (strain ATCC BAA-1116)
C4L8E9 1.83e-26 93 81 0 54 3 rpmF Large ribosomal subunit protein bL32 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
A3QDB8 2.27e-26 93 80 0 56 3 rpmF Large ribosomal subunit protein bL32 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
Q6LSX4 2.56e-26 93 76 0 56 3 rpmF Large ribosomal subunit protein bL32 Photobacterium profundum (strain SS9)
B3PEU8 3.76e-26 92 78 0 56 3 rpmF Large ribosomal subunit protein bL32 Cellvibrio japonicus (strain Ueda107)
A8H5I1 5.29e-26 92 78 0 56 3 rpmF Large ribosomal subunit protein bL32 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B4S1N7 7.03e-26 92 78 0 55 3 rpmF Large ribosomal subunit protein bL32 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
A8FWL2 9.46e-26 91 76 0 56 3 rpmF Large ribosomal subunit protein bL32 Shewanella sediminis (strain HAW-EB3)
Q606L1 1.4e-25 91 77 0 54 3 rpmF Large ribosomal subunit protein bL32 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
B8D7N7 1.46e-25 91 74 0 54 3 rpmF Large ribosomal subunit protein bL32 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57431 1.46e-25 91 74 0 54 3 rpmF Large ribosomal subunit protein bL32 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D9D5 1.46e-25 91 74 0 54 3 rpmF Large ribosomal subunit protein bL32 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
B6EIZ6 1.48e-25 91 76 0 56 3 rpmF Large ribosomal subunit protein bL32 Aliivibrio salmonicida (strain LFI1238)
B8CR95 1.66e-25 90 76 0 56 3 rpmF Large ribosomal subunit protein bL32 Shewanella piezotolerans (strain WP3 / JCM 13877)
Q15TZ4 3.86e-25 90 74 0 55 3 rpmF Large ribosomal subunit protein bL32 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
B1KRB5 7.46e-25 89 76 0 56 3 rpmF Large ribosomal subunit protein bL32 Shewanella woodyi (strain ATCC 51908 / MS32)
B7VLX9 7.97e-25 89 73 0 56 3 rpmF Large ribosomal subunit protein bL32 Vibrio atlanticus (strain LGP32)
A4SMK3 8.4e-25 89 74 0 54 3 rpmF Large ribosomal subunit protein bL32 Aeromonas salmonicida (strain A449)
B0TQU3 9.4e-25 89 75 0 56 3 rpmF Large ribosomal subunit protein bL32 Shewanella halifaxensis (strain HAW-EB4)
A0KKH0 1.39e-24 88 74 0 54 3 rpmF Large ribosomal subunit protein bL32 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
C5BU55 2.5e-24 88 72 0 55 3 rpmF Large ribosomal subunit protein bL32 Teredinibacter turnerae (strain ATCC 39867 / T7901)
C1DR31 2.58e-24 88 71 0 56 3 rpmF Large ribosomal subunit protein bL32 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q21K91 3.44e-24 87 70 0 55 3 rpmF Large ribosomal subunit protein bL32 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
Q9RA36 3.71e-24 87 75 0 56 3 rpmF Large ribosomal subunit protein bL32 Moritella marina
Q492Q2 4.19e-24 87 75 0 56 3 rpmF Large ribosomal subunit protein bL32 Blochmanniella pennsylvanica (strain BPEN)
Q89AH1 4.81e-24 87 72 0 54 3 rpmF Large ribosomal subunit protein bL32 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
A4VMS4 1.55e-23 86 69 0 56 3 rpmF Large ribosomal subunit protein bL32 Stutzerimonas stutzeri (strain A1501)
Q9HZN4 1.6e-23 86 67 0 56 1 rpmF Large ribosomal subunit protein bL32 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02PD3 1.6e-23 86 67 0 56 3 rpmF Large ribosomal subunit protein bL32 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V159 1.6e-23 86 67 0 56 3 rpmF Large ribosomal subunit protein bL32 Pseudomonas aeruginosa (strain LESB58)
A6V3C8 1.6e-23 86 67 0 56 3 rpmF Large ribosomal subunit protein bL32 Pseudomonas aeruginosa (strain PA7)
Q3K8K7 1.63e-23 86 71 0 56 3 rpmF Large ribosomal subunit protein bL32 Pseudomonas fluorescens (strain Pf0-1)
C3K0N7 1.63e-23 86 71 0 56 3 rpmF Large ribosomal subunit protein bL32 Pseudomonas fluorescens (strain SBW25)
Q4KFS0 1.63e-23 86 71 0 56 3 rpmF Large ribosomal subunit protein bL32 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q8K9J7 1.64e-23 85 72 0 54 3 rpmF Large ribosomal subunit protein bL32 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q4ZVY0 1.91e-23 85 71 0 56 3 rpmF Large ribosomal subunit protein bL32 Pseudomonas syringae pv. syringae (strain B728a)
Q87YG4 1.91e-23 85 71 0 56 3 rpmF Large ribosomal subunit protein bL32 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48L44 1.91e-23 85 71 0 56 3 rpmF Large ribosomal subunit protein bL32 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q1QX57 3.45e-23 85 72 0 55 3 rpmF Large ribosomal subunit protein bL32 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
B1J4Y7 3.68e-23 85 71 0 56 3 rpmF Large ribosomal subunit protein bL32 Pseudomonas putida (strain W619)
Q1ICZ0 3.68e-23 85 71 0 56 3 rpmF Large ribosomal subunit protein bL32 Pseudomonas entomophila (strain L48)
A1U1T3 4.28e-23 85 69 0 55 3 rpmF Large ribosomal subunit protein bL32 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
A4XSS3 5.01e-23 84 69 0 56 3 rpmF Large ribosomal subunit protein bL32 Pseudomonas mendocina (strain ymp)
Q88LL9 6.97e-23 84 69 0 56 3 rpmF Large ribosomal subunit protein bL32 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KF52 6.97e-23 84 69 0 56 3 rpmF Large ribosomal subunit protein bL32 Pseudomonas putida (strain GB-1)
A5W717 6.97e-23 84 69 0 56 3 rpmF Large ribosomal subunit protein bL32 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q3JAK5 9.23e-23 84 74 0 54 3 rpmF Large ribosomal subunit protein bL32 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
B0UUY8 1.22e-22 84 85 0 56 3 rpmF Large ribosomal subunit protein bL32 Histophilus somni (strain 2336)
Q0I0V8 1.22e-22 84 85 0 56 3 rpmF Large ribosomal subunit protein bL32 Histophilus somni (strain 129Pt)
B3R215 1.51e-22 83 72 0 54 3 rpmF Large ribosomal subunit protein bL32 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
Q0K8L7 1.51e-22 83 72 0 54 3 rpmF Large ribosomal subunit protein bL32 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
A1STV9 1.56e-22 83 73 1 56 3 rpmF Large ribosomal subunit protein bL32 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q31HR9 1.56e-22 83 69 0 55 3 rpmF Large ribosomal subunit protein bL32 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q0A8R3 1.67e-22 83 70 0 55 3 rpmF Large ribosomal subunit protein bL32 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
Q3IHD7 2.02e-22 83 67 0 56 3 rpmF Large ribosomal subunit protein bL32 Pseudoalteromonas translucida (strain TAC 125)
Q87CL6 2.91e-22 83 70 0 54 3 rpmF Large ribosomal subunit protein bL32 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U2S7 2.91e-22 83 70 0 54 3 rpmF Large ribosomal subunit protein bL32 Xylella fastidiosa (strain M12)
B2I598 2.91e-22 83 70 0 54 3 rpmF Large ribosomal subunit protein bL32 Xylella fastidiosa (strain M23)
Q7VN20 3.14e-22 82 83 0 56 3 rpmF Large ribosomal subunit protein bL32 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B0BQX5 3.14e-22 82 83 0 56 3 rpmF Large ribosomal subunit protein bL32 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
A3N234 3.14e-22 82 83 0 56 3 rpmF Large ribosomal subunit protein bL32 Actinobacillus pleuropneumoniae serotype 5b (strain L20)
Q9PCG5 3.29e-22 82 70 0 54 3 rpmF Large ribosomal subunit protein bL32 Xylella fastidiosa (strain 9a5c)
B4SM96 3.47e-22 82 67 0 55 3 rpmF Large ribosomal subunit protein bL32 Stenotrophomonas maltophilia (strain R551-3)
Q65RD4 6.13e-22 82 83 0 56 3 rpmF Large ribosomal subunit protein bL32 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
P44368 6.13e-22 82 83 0 56 3 rpmF Large ribosomal subunit protein bL32 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UFW3 6.13e-22 82 83 0 56 3 rpmF Large ribosomal subunit protein bL32 Haemophilus influenzae (strain PittGG)
A5UAZ2 6.13e-22 82 83 0 56 3 rpmF Large ribosomal subunit protein bL32 Haemophilus influenzae (strain PittEE)
Q4QP29 6.13e-22 82 83 0 56 3 rpmF Large ribosomal subunit protein bL32 Haemophilus influenzae (strain 86-028NP)
A6VQV4 6.13e-22 82 83 0 56 3 rpmF Large ribosomal subunit protein bL32 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
Q3BWJ0 6.28e-22 82 70 0 54 3 rpmF Large ribosomal subunit protein bL32 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PNE9 6.28e-22 82 70 0 54 3 rpmF Large ribosomal subunit protein bL32 Xanthomonas axonopodis pv. citri (strain 306)
Q05I49 6.42e-22 82 69 0 55 3 rpmF Large ribosomal subunit protein bL32 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
Q2P7C0 6.42e-22 82 69 0 55 3 rpmF Large ribosomal subunit protein bL32 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8PBV2 6.42e-22 82 69 0 55 3 rpmF Large ribosomal subunit protein bL32 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RYI8 6.42e-22 82 69 0 55 3 rpmF Large ribosomal subunit protein bL32 Xanthomonas campestris pv. campestris (strain B100)
Q4URP9 6.42e-22 82 69 0 55 3 rpmF Large ribosomal subunit protein bL32 Xanthomonas campestris pv. campestris (strain 8004)
A6VX72 7.36e-22 82 69 0 55 3 rpmF Large ribosomal subunit protein bL32 Marinomonas sp. (strain MWYL1)
Q46Z03 7.78e-22 82 70 0 54 3 rpmF Large ribosomal subunit protein bL32 Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
Q1LKL7 7.78e-22 82 70 0 54 3 rpmF Large ribosomal subunit protein bL32 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
Q8D3B2 9.91e-22 81 66 0 56 3 rpmF Large ribosomal subunit protein bL32 Wigglesworthia glossinidia brevipalpis
A1WWF0 1.25e-21 81 69 0 53 3 rpmF Large ribosomal subunit protein bL32 Halorhodospira halophila (strain DSM 244 / SL1)
B2FR85 1.25e-21 81 67 0 55 3 rpmF Large ribosomal subunit protein bL32 Stenotrophomonas maltophilia (strain K279a)
A4G6T4 1.28e-21 81 66 0 54 3 rpmF Large ribosomal subunit protein bL32 Herminiimonas arsenicoxydans
Q7VR16 1.49e-21 80 67 0 56 3 rpmF Large ribosomal subunit protein bL32 Blochmanniella floridana
A6SXP7 1.84e-21 80 66 0 54 3 rpmF Large ribosomal subunit protein bL32 Janthinobacterium sp. (strain Marseille)
B3GYG5 3.15e-21 80 82 0 56 3 rpmF Large ribosomal subunit protein bL32 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
Q0AIS2 3.59e-21 80 62 0 54 3 rpmF Large ribosomal subunit protein bL32 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
Q0BH19 4.92e-21 79 64 0 54 3 rpmF Large ribosomal subunit protein bL32 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
Q83E41 5.11e-21 80 60 0 55 3 rpmF Large ribosomal subunit protein bL32 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9NBY1 5.11e-21 80 60 0 55 3 rpmF Large ribosomal subunit protein bL32 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KEA3 5.11e-21 80 60 0 55 3 rpmF Large ribosomal subunit protein bL32 Coxiella burnetii (strain Dugway 5J108-111)
B6J1I8 5.11e-21 80 60 0 55 3 rpmF Large ribosomal subunit protein bL32 Coxiella burnetii (strain CbuG_Q212)
B6J8E7 5.11e-21 80 60 0 55 3 rpmF Large ribosomal subunit protein bL32 Coxiella burnetii (strain CbuK_Q154)
Q9CJS9 6.08e-21 79 80 0 56 3 rpmF Large ribosomal subunit protein bL32 Pasteurella multocida (strain Pm70)
Q1H160 6.55e-21 79 66 0 54 3 rpmF Large ribosomal subunit protein bL32 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q8Y0J6 6.62e-21 79 64 0 54 3 rpmF Large ribosomal subunit protein bL32 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
B2U966 8.07e-21 79 64 0 54 3 rpmF Large ribosomal subunit protein bL32 Ralstonia pickettii (strain 12J)
Q82U62 8.64e-21 79 62 0 54 3 rpmF Large ribosomal subunit protein bL32 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
A1AWD4 9.28e-21 79 64 0 56 3 rpmF Large ribosomal subunit protein bL32 Ruthia magnifica subsp. Calyptogena magnifica
Q2YA48 1.7e-20 78 66 0 54 3 rpmF Large ribosomal subunit protein bL32 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
A1TLD5 1.73e-20 78 61 0 54 3 rpmF Large ribosomal subunit protein bL32 Paracidovorax citrulli (strain AAC00-1)
A2SDF7 1.95e-20 78 62 0 54 3 rpmF Large ribosomal subunit protein bL32 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
A4SVV2 2.07e-20 78 62 0 54 3 rpmF Large ribosomal subunit protein bL32 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q126I6 2.17e-20 78 62 0 54 3 rpmF Large ribosomal subunit protein bL32 Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q13VL3 2.32e-20 78 62 0 54 3 rpmF Large ribosomal subunit protein bL32 Paraburkholderia xenovorans (strain LB400)
B2T5U4 2.32e-20 78 62 0 54 3 rpmF Large ribosomal subunit protein bL32 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
A4JCP6 2.32e-20 78 62 0 54 3 rpmF Large ribosomal subunit protein bL32 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q1BXV6 2.32e-20 78 62 0 54 3 rpmF Large ribosomal subunit protein bL32 Burkholderia orbicola (strain AU 1054)
B1JY98 2.32e-20 78 62 0 54 3 rpmF Large ribosomal subunit protein bL32 Burkholderia orbicola (strain MC0-3)
Q39I88 2.32e-20 78 62 0 54 3 rpmF Large ribosomal subunit protein bL32 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
A0K5U4 2.32e-20 78 62 0 54 3 rpmF Large ribosomal subunit protein bL32 Burkholderia cenocepacia (strain HI2424)
B1YVK9 2.32e-20 78 62 0 54 3 rpmF Large ribosomal subunit protein bL32 Burkholderia ambifaria (strain MC40-6)
Q0VQN4 2.91e-20 77 62 0 56 3 rpmF Large ribosomal subunit protein bL32 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
A5CWU9 3.07e-20 78 60 0 56 3 rpmF Large ribosomal subunit protein bL32 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A1WMX7 3.12e-20 77 61 0 54 3 rpmF Large ribosomal subunit protein bL32 Verminephrobacter eiseniae (strain EF01-2)
A9ADF3 3.15e-20 77 61 0 54 3 rpmF Large ribosomal subunit protein bL32 Burkholderia multivorans (strain ATCC 17616 / 249)
B2JFI7 3.25e-20 77 61 0 54 3 rpmF Large ribosomal subunit protein bL32 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
A1WAY0 3.98e-20 77 59 0 54 3 rpmF Large ribosomal subunit protein bL32 Acidovorax sp. (strain JS42)
B9MDR1 3.98e-20 77 59 0 54 3 rpmF Large ribosomal subunit protein bL32 Acidovorax ebreus (strain TPSY)
C5CSE0 4.64e-20 77 61 0 54 3 rpmF Large ribosomal subunit protein bL32 Variovorax paradoxus (strain S110)
Q3SIM2 5.7e-20 77 61 0 54 3 rpmF Large ribosomal subunit protein bL32 Thiobacillus denitrificans (strain ATCC 25259)
Q0BLP6 5.71e-20 77 61 0 55 3 rpmF Large ribosomal subunit protein bL32 Francisella tularensis subsp. holarctica (strain OSU18)
A0Q7J5 5.71e-20 77 61 0 55 3 rpmF Large ribosomal subunit protein bL32 Francisella tularensis subsp. novicida (strain U112)
B2SFU4 5.71e-20 77 61 0 55 3 rpmF Large ribosomal subunit protein bL32 Francisella tularensis subsp. mediasiatica (strain FSC147)
Q2A373 5.71e-20 77 61 0 55 3 rpmF Large ribosomal subunit protein bL32 Francisella tularensis subsp. holarctica (strain LVS)
A7NCH9 5.71e-20 77 61 0 55 3 rpmF Large ribosomal subunit protein bL32 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
B8GSX9 7.81e-20 77 62 0 54 3 rpmF Large ribosomal subunit protein bL32 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q7NSK5 8.18e-20 76 59 0 54 3 rpmF Large ribosomal subunit protein bL32 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A1K5Y3 8.18e-20 76 59 0 54 3 rpmF Large ribosomal subunit protein bL32 Azoarcus sp. (strain BH72)
Q2SXU9 1.08e-19 76 59 0 54 3 rpmF Large ribosomal subunit protein bL32 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63S81 1.09e-19 76 59 0 54 3 rpmF Large ribosomal subunit protein bL32 Burkholderia pseudomallei (strain K96243)
A3NBU4 1.09e-19 76 59 0 54 3 rpmF Large ribosomal subunit protein bL32 Burkholderia pseudomallei (strain 668)
Q3JQ63 1.09e-19 76 59 0 54 3 rpmF Large ribosomal subunit protein bL32 Burkholderia pseudomallei (strain 1710b)
A3NXN1 1.09e-19 76 59 0 54 3 rpmF Large ribosomal subunit protein bL32 Burkholderia pseudomallei (strain 1106a)
A1V6D3 1.09e-19 76 59 0 54 3 rpmF Large ribosomal subunit protein bL32 Burkholderia mallei (strain SAVP1)
Q62LU4 1.09e-19 76 59 0 54 3 rpmF Large ribosomal subunit protein bL32 Burkholderia mallei (strain ATCC 23344)
A2S9Y0 1.09e-19 76 59 0 54 3 rpmF Large ribosomal subunit protein bL32 Burkholderia mallei (strain NCTC 10229)
A3MM58 1.09e-19 76 59 0 54 3 rpmF Large ribosomal subunit protein bL32 Burkholderia mallei (strain NCTC 10247)
A1KRZ4 1.15e-19 76 64 0 54 3 rpmF Large ribosomal subunit protein bL32 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
Q9JXS0 1.15e-19 76 64 0 54 3 rpmF Large ribosomal subunit protein bL32 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
A9M148 1.15e-19 76 64 0 54 3 rpmF Large ribosomal subunit protein bL32 Neisseria meningitidis serogroup C (strain 053442)
B0TY17 1.15e-19 76 60 0 55 3 rpmF Large ribosomal subunit protein bL32 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
A9BNK8 1.26e-19 76 61 0 54 3 rpmF Large ribosomal subunit protein bL32 Delftia acidovorans (strain DSM 14801 / SPH-1)
Q9JW52 1.3e-19 76 64 0 54 3 rpmF Large ribosomal subunit protein bL32 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A1VRU9 1.42e-19 76 61 0 54 3 rpmF Large ribosomal subunit protein bL32 Polaromonas naphthalenivorans (strain CJ2)
Q21XP6 1.79e-19 75 59 0 54 3 rpmF Large ribosomal subunit protein bL32 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A9IIG9 1.87e-19 75 61 0 54 3 rpmF Large ribosomal subunit protein bL32 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
A4IWY3 2.69e-19 75 60 0 55 3 rpmF Large ribosomal subunit protein bL32 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NF72 2.69e-19 75 60 0 55 3 rpmF Large ribosomal subunit protein bL32 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
Q14GM5 2.69e-19 75 60 0 55 3 rpmF Large ribosomal subunit protein bL32 Francisella tularensis subsp. tularensis (strain FSC 198)
B1XTK4 2.77e-19 75 61 0 54 3 rpmF Large ribosomal subunit protein bL32 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
C1DCF0 3.64e-19 75 55 0 54 3 rpmF Large ribosomal subunit protein bL32 Laribacter hongkongensis (strain HLHK9)
Q7VW27 5.31e-19 74 59 0 54 3 rpmF Large ribosomal subunit protein bL32 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W5I2 5.31e-19 74 59 0 54 3 rpmF Large ribosomal subunit protein bL32 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WD18 5.31e-19 74 59 0 54 3 rpmF Large ribosomal subunit protein bL32 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q2KUK7 5.31e-19 74 57 0 54 3 rpmF Large ribosomal subunit protein bL32 Bordetella avium (strain 197N)
A5EXD5 7.46e-19 74 64 0 54 3 rpmF Large ribosomal subunit protein bL32 Dichelobacter nodosus (strain VCS1703A)
B1XZP2 7.71e-19 74 59 0 54 3 rpmF Large ribosomal subunit protein bL32 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
B4RJI8 9.37e-19 73 62 0 54 3 rpmF Large ribosomal subunit protein bL32 Neisseria gonorrhoeae (strain NCCP11945)
Q5F4X1 9.37e-19 73 62 0 54 3 rpmF Large ribosomal subunit protein bL32 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q47EH3 4.4e-18 72 58 0 53 3 rpmF Large ribosomal subunit protein bL32 Dechloromonas aromatica (strain RCB)
Q5P0D8 8.7e-18 71 57 0 54 3 rpmF Large ribosomal subunit protein bL32 Aromatoleum aromaticum (strain DSM 19018 / LMG 30748 / EbN1)
Q5WWV7 1.07e-17 71 70 0 55 3 rpmF Large ribosomal subunit protein bL32 Legionella pneumophila (strain Lens)
Q5ZVP9 1.07e-17 71 70 0 55 3 rpmF Large ribosomal subunit protein bL32 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IBN3 1.07e-17 71 70 0 55 3 rpmF Large ribosomal subunit protein bL32 Legionella pneumophila (strain Corby)
Q5X5H4 1.07e-17 71 70 0 55 3 rpmF Large ribosomal subunit protein bL32 Legionella pneumophila (strain Paris)
Q5QZ37 1.41e-16 68 69 0 56 3 rpmF Large ribosomal subunit protein bL32 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
B8F6D3 6.51e-16 66 77 1 53 3 rpmF Large ribosomal subunit protein bL32 Glaesserella parasuis serovar 5 (strain SH0165)
Q2SK53 5.77e-15 64 67 0 55 3 rpmF Large ribosomal subunit protein bL32 Hahella chejuensis (strain KCTC 2396)
B0V8F1 3.28e-14 62 62 0 56 3 rpmF Large ribosomal subunit protein bL32 Acinetobacter baumannii (strain AYE)
A3M2W0 3.28e-14 62 62 0 56 3 rpmF Large ribosomal subunit protein bL32 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VTY5 3.28e-14 62 62 0 56 3 rpmF Large ribosomal subunit protein bL32 Acinetobacter baumannii (strain SDF)
B2HUL1 3.28e-14 62 62 0 56 3 rpmF Large ribosomal subunit protein bL32 Acinetobacter baumannii (strain ACICU)
B7I7A4 3.28e-14 62 62 0 56 1 rpmF Large ribosomal subunit protein bL32 Acinetobacter baumannii (strain AB0057)
B7GYS1 3.28e-14 62 62 0 56 3 rpmF Large ribosomal subunit protein bL32 Acinetobacter baumannii (strain AB307-0294)
Q6FDU0 5.26e-14 62 64 0 56 3 rpmF Large ribosomal subunit protein bL32 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q482K3 4.63e-13 59 66 0 54 3 rpmF Large ribosomal subunit protein bL32 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q5PA96 4.26e-12 57 52 0 53 3 rpmF Large ribosomal subunit protein bL32 Anaplasma marginale (strain St. Maries)
B9KJ30 4.26e-12 57 52 0 53 3 rpmF Large ribosomal subunit protein bL32 Anaplasma marginale (strain Florida)
Q2GDD5 6.81e-12 57 49 0 55 3 rpmF Large ribosomal subunit protein bL32 Neorickettsia sennetsu (strain ATCC VR-367 / Miyayama)
Q0APT4 1.35e-11 55 53 1 56 3 rpmF Large ribosomal subunit protein bL32 Maricaulis maris (strain MCS10)
Q5HAV7 3.67e-11 55 42 0 54 3 rpmF Large ribosomal subunit protein bL32 Ehrlichia ruminantium (strain Welgevonden)
Q5FFT3 3.67e-11 55 42 0 54 3 rpmF Large ribosomal subunit protein bL32 Ehrlichia ruminantium (strain Gardel)
Q057L5 4.33e-11 54 57 0 42 3 rpmF Large ribosomal subunit protein bL32 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q2GL24 1.22e-10 53 49 0 53 3 rpmF Large ribosomal subunit protein bL32 Anaplasma phagocytophilum (strain HZ)
B5EJC7 2.53e-10 52 45 1 57 3 rpmF Large ribosomal subunit protein bL32 Acidithiobacillus ferrooxidans (strain ATCC 53993 / BNL-5-31)
B7JC05 2.53e-10 52 45 1 57 3 rpmF Large ribosomal subunit protein bL32 Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)
A8EZX4 3.86e-10 52 50 1 57 3 rpmF Large ribosomal subunit protein bL32 Rickettsia canadensis (strain McKiel)
Q28RF9 4.31e-10 52 52 1 55 3 rpmF Large ribosomal subunit protein bL32 Jannaschia sp. (strain CCS1)
Q11CS8 5.56e-10 52 53 1 56 3 rpmF Large ribosomal subunit protein bL32 Chelativorans sp. (strain BNC1)
A6WXZ4 6.62e-10 51 51 1 56 3 rpmF Large ribosomal subunit protein bL32 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
Q2GH19 7.32e-10 51 44 0 54 3 rpmF Large ribosomal subunit protein bL32 Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas)
B9JDZ7 7.56e-10 51 52 1 55 3 rpmF Large ribosomal subunit protein bL32 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q98FG9 1e-09 51 52 1 55 3 rpmF Large ribosomal subunit protein bL32 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
Q68VX6 1.08e-09 51 49 1 57 3 rpmF Large ribosomal subunit protein bL32 Rickettsia typhi (strain ATCC VR-144 / Wilmington)
B5ZU94 1.1e-09 51 52 1 55 3 rpmF Large ribosomal subunit protein bL32 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q1MAD1 1.1e-09 51 52 1 55 3 rpmF Large ribosomal subunit protein bL32 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
Q2K327 1.1e-09 51 52 1 55 3 rpmF Large ribosomal subunit protein bL32 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PR77 1.1e-09 51 52 1 55 3 rpmF Large ribosomal subunit protein bL32 Rhizobium etli (strain CIAT 652)
Q92L25 1.16e-09 51 52 1 55 3 rpmF Large ribosomal subunit protein bL32 Rhizobium meliloti (strain 1021)
Q4UK48 1.22e-09 51 49 1 57 3 rpmF Large ribosomal subunit protein bL32 Rickettsia felis (strain ATCC VR-1525 / URRWXCal2)
A6UE65 1.22e-09 51 52 1 55 3 rpmF Large ribosomal subunit protein bL32 Sinorhizobium medicae (strain WSM419)
A8GPW2 1.45e-09 51 49 1 57 3 rpmF Large ribosomal subunit protein bL32 Rickettsia akari (strain Hartford)
Q9ZCH0 1.48e-09 50 49 1 57 3 rpmF Large ribosomal subunit protein bL32 Rickettsia prowazekii (strain Madrid E)
Q1RKA6 1.73e-09 50 49 1 57 3 rpmF Large ribosomal subunit protein bL32 Rickettsia bellii (strain RML369-C)
A8GY07 1.73e-09 50 49 1 57 3 rpmF Large ribosomal subunit protein bL32 Rickettsia bellii (strain OSU 85-389)
P66206 1.74e-09 50 50 1 56 3 rpmF Large ribosomal subunit protein bL32 Brucella suis biovar 1 (strain 1330)
A9WWP9 1.74e-09 50 50 1 56 3 rpmF Large ribosomal subunit protein bL32 Brucella suis (strain ATCC 23445 / NCTC 10510)
A5VSC1 1.74e-09 50 50 1 56 3 rpmF Large ribosomal subunit protein bL32 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P66205 1.74e-09 50 50 1 56 3 rpmF Large ribosomal subunit protein bL32 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RF29 1.74e-09 50 50 1 56 3 rpmF Large ribosomal subunit protein bL32 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M817 1.74e-09 50 50 1 56 3 rpmF Large ribosomal subunit protein bL32 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57BA8 1.74e-09 50 50 1 56 3 rpmF Large ribosomal subunit protein bL32 Brucella abortus biovar 1 (strain 9-941)
Q2YLD3 1.74e-09 50 50 1 56 3 rpmF Large ribosomal subunit protein bL32 Brucella abortus (strain 2308)
B2S7K3 1.74e-09 50 50 1 56 3 rpmF Large ribosomal subunit protein bL32 Brucella abortus (strain S19)
Q3J363 1.79e-09 50 50 1 55 3 rpmF Large ribosomal subunit protein bL32 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PJ66 1.79e-09 50 50 1 55 3 rpmF Large ribosomal subunit protein bL32 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
B8J183 1.86e-09 50 47 2 57 3 rpmF Large ribosomal subunit protein bL32 Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB)
Q6G107 2.09e-09 50 52 1 55 3 rpmF Large ribosomal subunit protein bL32 Bartonella quintana (strain Toulouse)
Q3YRP5 2.17e-09 50 42 0 54 3 rpmF Large ribosomal subunit protein bL32 Ehrlichia canis (strain Jake)
Q6G1X6 2.23e-09 50 52 1 55 3 rpmF Large ribosomal subunit protein bL32 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A4WTT7 2.69e-09 50 50 1 55 3 rpmF Large ribosomal subunit protein bL32 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
A1UR57 3.28e-09 50 52 1 55 3 rpmF Large ribosomal subunit protein bL32 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
A8LLT2 3.49e-09 50 52 1 55 3 rpmF Large ribosomal subunit protein bL32 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
A8GTP3 4.06e-09 50 49 1 57 3 rpmF Large ribosomal subunit protein bL32 Rickettsia rickettsii (strain Sheila Smith)
B0BV81 4.06e-09 50 49 1 57 3 rpmF Large ribosomal subunit protein bL32 Rickettsia rickettsii (strain Iowa)
C4K1E1 4.06e-09 50 49 1 57 3 rpmF Large ribosomal subunit protein bL32 Rickettsia peacockii (strain Rustic)
Q92GC0 4.06e-09 50 49 1 57 3 rpmF Large ribosomal subunit protein bL32 Rickettsia conorii (strain ATCC VR-613 / Malish 7)
C3PLQ4 4.06e-09 50 49 1 57 3 rpmF Large ribosomal subunit protein bL32 Rickettsia africae (strain ESF-5)
B1LV66 4.62e-09 49 50 1 56 3 rpmF Large ribosomal subunit protein bL32 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
B1Z7L0 4.62e-09 49 50 1 56 3 rpmF Large ribosomal subunit protein bL32 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A9W7T2 4.62e-09 49 50 1 56 3 rpmF Large ribosomal subunit protein bL32 Methylorubrum extorquens (strain PA1)
Q9APJ2 4.62e-09 49 50 1 56 3 rpmF Large ribosomal subunit protein bL32 Methylorubrum extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)
B7KX68 4.62e-09 49 50 1 56 3 rpmF Large ribosomal subunit protein bL32 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
B0UPF9 4.66e-09 49 50 1 56 3 rpmF Large ribosomal subunit protein bL32 Methylobacterium sp. (strain 4-46)
B8ISU9 4.66e-09 49 50 1 56 3 rpmF Large ribosomal subunit protein bL32 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
B9JV13 4.77e-09 49 50 1 55 3 rpmF Large ribosomal subunit protein bL32 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
Q5LQJ7 4.8e-09 49 49 1 55 3 rpmF Large ribosomal subunit protein bL32 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
Q04FS5 5.09e-09 49 44 0 54 3 rpmF Large ribosomal subunit protein bL32 Oenococcus oeni (strain ATCC BAA-331 / PSU-1)
Q73GG7 6.84e-09 49 44 0 56 3 rpmF Large ribosomal subunit protein bL32 Wolbachia pipientis wMel
A9IYV7 7.62e-09 48 50 1 55 3 rpmF Large ribosomal subunit protein bL32 Bartonella tribocorum (strain CIP 105476 / IBS 506)
P30788 8.03e-09 49 49 1 55 3 rpmF Large ribosomal subunit protein bL32 Rhodobacter capsulatus
Q13EE0 1.12e-08 48 49 1 57 3 rpmF Large ribosomal subunit protein bL32 Rhodopseudomonas palustris (strain BisB5)
Q2J2T5 1.12e-08 48 49 1 57 3 rpmF Large ribosomal subunit protein bL32 Rhodopseudomonas palustris (strain HaA2)
A7HTE5 1.18e-08 48 49 1 55 3 rpmF Large ribosomal subunit protein bL32 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
Q21C12 1.46e-08 48 47 1 57 3 rpmF Large ribosomal subunit protein bL32 Rhodopseudomonas palustris (strain BisB18)
Q8UJ26 1.7e-08 48 49 1 55 3 rpmF Large ribosomal subunit protein bL32 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q1QDF6 1.75e-08 48 53 0 54 3 rpmF Large ribosomal subunit protein bL32 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
A1B362 1.88e-08 48 49 1 55 3 rpmF Large ribosomal subunit protein bL32 Paracoccus denitrificans (strain Pd 1222)
Q4FUC6 2.41e-08 47 51 0 54 3 rpmF Large ribosomal subunit protein bL32 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
Q6MLJ4 2.41e-08 47 45 2 57 3 rpmF Large ribosomal subunit protein bL32 Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100)
B2IE54 2.55e-08 47 48 1 56 3 rpmF Large ribosomal subunit protein bL32 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
A5WCL9 2.72e-08 47 51 0 54 3 rpmF Large ribosomal subunit protein bL32 Psychrobacter sp. (strain PRwf-1)
B8ER45 2.94e-08 47 49 1 55 3 rpmF Large ribosomal subunit protein bL32 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q7C3S2 3.27e-08 47 37 0 56 3 rpmF1 Large ribosomal subunit protein bL32A Enterococcus faecalis (strain ATCC 700802 / V583)
Q2G5R9 4.03e-08 47 49 1 55 3 rpmF Large ribosomal subunit protein bL32 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
Q5GS20 4.03e-08 47 41 0 56 3 rpmF Large ribosomal subunit protein bL32 Wolbachia sp. subsp. Brugia malayi (strain TRS)
Q1QQI4 4.36e-08 47 46 1 56 3 rpmF Large ribosomal subunit protein bL32 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q3SVC7 4.65e-08 47 46 1 56 3 rpmF Large ribosomal subunit protein bL32 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
A0AFU3 4.75e-08 47 37 0 56 3 rpmF1 Large ribosomal subunit protein bL32A Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
Q92EH1 4.75e-08 47 37 0 56 3 rpmF1 Large ribosomal subunit protein bL32A Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
A7IJZ8 6.46e-08 46 46 1 56 3 rpmF Large ribosomal subunit protein bL32 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q039I6 6.47e-08 47 37 0 56 3 rpmF Large ribosomal subunit protein bL32 Lacticaseibacillus paracasei (strain ATCC 334 / BCRC 17002 / CCUG 31169 / CIP 107868 / KCTC 3260 / NRRL B-441)
B3WE58 6.47e-08 47 37 0 56 3 rpmF Large ribosomal subunit protein bL32 Lacticaseibacillus casei (strain BL23)
A8IJI4 7.62e-08 46 46 1 56 3 rpmF Large ribosomal subunit protein bL32 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
Q7C3P5 9.79e-08 46 38 0 54 3 rpmF2 Large ribosomal subunit protein bL32B Enterococcus faecalis (strain ATCC 700802 / V583)
Q3A4M7 1.08e-07 46 42 1 56 3 rpmF Large ribosomal subunit protein bL32 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
Q07VA0 1.37e-07 45 45 1 57 3 rpmF Large ribosomal subunit protein bL32 Rhodopseudomonas palustris (strain BisA53)
Q89VU7 1.42e-07 45 45 1 57 3 rpmF Large ribosomal subunit protein bL32 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
B3CML3 1.45e-07 45 39 0 56 3 rpmF Large ribosomal subunit protein bL32 Wolbachia pipientis subsp. Culex pipiens (strain wPip)
A4YKR8 1.48e-07 45 45 1 57 3 rpmF Large ribosomal subunit protein bL32 Bradyrhizobium sp. (strain ORS 278)
A5ETH1 1.48e-07 45 45 1 57 3 rpmF Large ribosomal subunit protein bL32 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
A1VEJ9 1.81e-07 45 48 2 54 3 rpmF Large ribosomal subunit protein bL32 Nitratidesulfovibrio vulgaris (strain DP4)
Q72CS4 1.81e-07 45 48 2 54 3 rpmF Large ribosomal subunit protein bL32 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
Q8DRV7 1.91e-07 45 39 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus mutans serotype c (strain ATCC 700610 / UA159)
P75238 2.06e-07 45 45 0 48 1 rpmF Large ribosomal subunit protein bL32 Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1)
B3QBD3 2.3e-07 45 45 1 57 3 rpmF Large ribosomal subunit protein bL32 Rhodopseudomonas palustris (strain TIE-1)
Q6NCE6 2.3e-07 45 45 1 57 1 rpmF Large ribosomal subunit protein bL32 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
B6JA22 2.3e-07 45 46 1 56 3 rpmF Large ribosomal subunit protein bL32 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
B8DCI6 2.46e-07 45 35 0 56 3 rpmF Large ribosomal subunit protein bL32 Listeria monocytogenes serotype 4a (strain HCC23)
Q8Y9N9 2.46e-07 45 35 0 56 3 rpmF1 Large ribosomal subunit protein bL32A Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
Q723G3 2.46e-07 45 35 0 56 3 rpmF1 Large ribosomal subunit protein bL32A Listeria monocytogenes serotype 4b (strain F2365)
P47603 2.89e-07 45 45 0 48 3 rpmF Large ribosomal subunit protein bL32 Mycoplasma genitalium (strain ATCC 33530 / DSM 19775 / NCTC 10195 / G37)
A3CR43 3.34e-07 45 37 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus sanguinis (strain SK36)
Q1GT88 3.89e-07 44 43 1 55 3 rpmF Large ribosomal subunit protein bL32 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
Q043V6 4.74e-07 44 39 0 56 3 rpmF Large ribosomal subunit protein bL32 Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / BCRC 14619 / CIP 102991 / JCM 1131 / KCTC 3163 / NCIMB 11718 / NCTC 13722 / AM63)
Q74JN2 5.06e-07 44 39 0 56 3 rpmF Large ribosomal subunit protein bL32 Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533)
Q38WU0 5.11e-07 44 37 0 54 3 rpmF Large ribosomal subunit protein bL32 Latilactobacillus sakei subsp. sakei (strain 23K)
A8AZV3 5.52e-07 44 37 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus gordonii (strain Challis / ATCC 35105 / BCRC 15272 / CH1 / DL1 / V288)
B1MZN8 5.58e-07 44 39 0 56 3 rpmF Large ribosomal subunit protein bL32 Leuconostoc citreum (strain KM20)
A4VT06 5.77e-07 44 37 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus suis (strain 05ZYH33)
A4VZ91 5.77e-07 44 37 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus suis (strain 98HAH33)
Q04B07 6.16e-07 44 39 0 56 3 rpmF Large ribosomal subunit protein bL32 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365 / Lb-18)
Q1GAM0 6.16e-07 44 39 0 56 3 rpmF Large ribosomal subunit protein bL32 Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)
Q1GI67 6.23e-07 44 41 1 55 3 rpmF Large ribosomal subunit protein bL32 Ruegeria sp. (strain TM1040)
C1CH67 6.37e-07 44 37 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus pneumoniae (strain JJA)
Q97NB7 6.37e-07 44 37 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4)
C1CU40 6.51e-07 44 37 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus pneumoniae (strain Taiwan19F-14)
C1CNB3 6.51e-07 44 37 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus pneumoniae (strain P1031)
Q8CWN3 6.51e-07 44 37 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus pneumoniae (strain ATCC BAA-255 / R6)
B2IN60 6.51e-07 44 37 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus pneumoniae (strain CGSP14)
B8ZPX5 6.51e-07 44 37 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1)
B1I9V0 6.51e-07 44 37 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus pneumoniae (strain Hungary19A-6)
C1CAX9 6.51e-07 44 37 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus pneumoniae (strain 70585)
B5E3E2 6.51e-07 44 37 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus pneumoniae serotype 19F (strain G54)
Q04I37 6.51e-07 44 37 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466)
B3CQD5 6.66e-07 44 49 1 55 3 rpmF Large ribosomal subunit protein bL32 Orientia tsutsugamushi (strain Ikeda)
B9DW82 7.18e-07 43 39 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus uberis (strain ATCC BAA-854 / 0140J)
B5XJ84 8.55e-07 43 39 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus pyogenes serotype M49 (strain NZ131)
P0DE41 8.55e-07 43 39 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus pyogenes serotype M3 (strain SSI-1)
Q48QS6 8.55e-07 43 39 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus pyogenes serotype M28 (strain MGAS6180)
A2RGY2 8.55e-07 43 39 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus pyogenes serotype M5 (strain Manfredo)
Q1J479 8.55e-07 43 39 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus pyogenes serotype M4 (strain MGAS10750)
Q1JEG1 8.55e-07 43 39 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus pyogenes serotype M2 (strain MGAS10270)
Q1JJG0 8.55e-07 43 39 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus pyogenes serotype M12 (strain MGAS9429)
Q1J9B2 8.55e-07 43 39 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus pyogenes serotype M12 (strain MGAS2096)
P66213 8.55e-07 43 39 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus pyogenes serotype M18 (strain MGAS8232)
Q5X9E4 8.55e-07 43 39 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394)
P0DE40 8.55e-07 43 39 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315)
Q99XK8 8.55e-07 43 39 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus pyogenes serotype M1
P66214 8.55e-07 43 39 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus agalactiae serotype III (strain NEM316)
Q3JYL5 8.55e-07 43 39 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700)
C0MGD6 8.65e-07 43 39 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus equi subsp. zooepidemicus (strain H70)
B4U0K7 8.94e-07 43 39 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus equi subsp. zooepidemicus (strain MGCS10565)
Q2RTT0 9.14e-07 43 42 1 57 3 rpmF Large ribosomal subunit protein bL32 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q03IB0 9.76e-07 43 39 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9)
Q5M278 9.76e-07 43 39 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311)
Q5LXM6 9.76e-07 43 39 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus thermophilus (strain CNRZ 1066)
Q164D1 9.76e-07 43 41 1 55 3 rpmF Large ribosomal subunit protein bL32 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
Q03W83 9.87e-07 43 37 0 56 3 rpmF Large ribosomal subunit protein bL32 Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y)
Q74CS3 1.01e-06 43 40 1 55 3 rpmF Large ribosomal subunit protein bL32 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A8YV19 1.34e-06 43 40 0 54 3 rpmF Large ribosomal subunit protein bL32 Lactobacillus helveticus (strain DPC 4571)
Q5FKH0 1.34e-06 43 40 0 54 3 rpmF Large ribosomal subunit protein bL32 Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM)
Q5FUN5 1.35e-06 43 45 1 55 3 rpmF Large ribosomal subunit protein bL32 Gluconobacter oxydans (strain 621H)
Q033B8 1.46e-06 43 41 0 53 3 rpmF Large ribosomal subunit protein bL32 Lactococcus lactis subsp. cremoris (strain SK11)
A2RHH0 1.46e-06 43 41 0 53 1 rpmF Large ribosomal subunit protein bL32 Lactococcus lactis subsp. cremoris (strain MG1363)
Q9CJA6 1.46e-06 43 41 0 53 3 rpmF Large ribosomal subunit protein bL32 Lactococcus lactis subsp. lactis (strain IL1403)
O34101 1.61e-06 43 41 0 53 3 rpmF Large ribosomal subunit protein bL32 Lactococcus lactis subsp. cremoris
Q0C0R2 1.92e-06 43 41 1 56 3 rpmF Large ribosomal subunit protein bL32 Hyphomonas neptunium (strain ATCC 15444)
A5CCS3 1.94e-06 43 47 1 55 3 rpmF Large ribosomal subunit protein bL32 Orientia tsutsugamushi (strain Boryong)
Q2W4R9 2.61e-06 42 41 1 55 3 rpmF Large ribosomal subunit protein bL32 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q8DWV3 3.01e-06 42 39 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R)
Q0BTE2 3.21e-06 42 44 1 54 3 rpmF Large ribosomal subunit protein bL32 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
B8GW65 3.25e-06 42 43 1 55 3 rpmF Large ribosomal subunit protein bL32 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A7K2 3.25e-06 42 43 1 55 3 rpmF Large ribosomal subunit protein bL32 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B6IMR7 3.59e-06 42 41 1 55 3 rpmF Large ribosomal subunit protein bL32 Rhodospirillum centenum (strain ATCC 51521 / SW)
Q7NBW2 3.88e-06 42 41 0 48 3 rpmF Large ribosomal subunit protein bL32 Mycoplasmoides gallisepticum (strain R(low / passage 15 / clone 2))
P49228 7.47e-06 41 43 3 55 1 rpmF Large ribosomal subunit protein bL32 Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1)
Q1J2G7 8.99e-06 41 40 1 54 3 rpmF Large ribosomal subunit protein bL32 Deinococcus geothermalis (strain DSM 11300 / CIP 105573 / AG-3a)
A1APT2 9.09e-06 41 37 1 56 3 rpmF Large ribosomal subunit protein bL32 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
C0MB23 9.19e-06 41 37 0 53 3 rpmF Large ribosomal subunit protein bL32 Streptococcus equi subsp. equi (strain 4047)
A5VC84 9.4e-06 41 40 1 55 3 rpmF Large ribosomal subunit protein bL32 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
Q4FLU5 9.81e-06 41 42 2 57 3 rpmF Large ribosomal subunit protein bL32 Pelagibacter ubique (strain HTCC1062)
Q39V95 2.16e-05 40 36 1 55 3 rpmF Large ribosomal subunit protein bL32 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
A5FV67 4.87e-05 39 41 1 55 3 rpmF Large ribosomal subunit protein bL32 Acidiphilium cryptum (strain JF-5)
B8DJG3 4.9e-05 39 45 2 55 3 rpmF Large ribosomal subunit protein bL32 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
C1CYB8 7.26e-05 38 38 1 54 3 rpmF Large ribosomal subunit protein bL32 Deinococcus deserti (strain DSM 17065 / CIP 109153 / LMG 22923 / VCD115)
Q8A138 7.91e-05 38 35 1 57 3 rpmF Large ribosomal subunit protein bL32 Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50)
Q64NV0 7.91e-05 38 35 1 57 3 rpmF Large ribosomal subunit protein bL32 Bacteroides fragilis (strain YCH46)
B3E2K0 0.00012 38 35 1 54 3 rpmF Large ribosomal subunit protein bL32 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
O84816 0.000128 38 34 1 55 3 rpmF Large ribosomal subunit protein bL32 Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
Q3KKN1 0.000128 38 34 1 55 3 rpmF Large ribosomal subunit protein bL32 Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
C6BYD8 0.000145 38 42 2 56 3 rpmF Large ribosomal subunit protein bL32 Maridesulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIMB 8403 / VKM B-1763)
A0M6N7 0.000461 37 37 1 58 3 rpmF Large ribosomal subunit protein bL32 Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q255Q9 0.00048 37 34 1 55 3 rpmF Large ribosomal subunit protein bL32 Chlamydia felis (strain Fe/C-56)
B2G896 0.000513 37 35 1 56 3 rpmF Large ribosomal subunit protein bL32 Limosilactobacillus reuteri subsp. reuteri (strain JCM 1112)
A5VKW2 0.000513 37 35 1 56 3 rpmF Large ribosomal subunit protein bL32 Limosilactobacillus reuteri (strain DSM 20016)
B5ZBE3 0.000515 36 38 1 54 3 rpmF Large ribosomal subunit protein bL32 Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western)
A0LI08 0.000536 37 37 1 56 3 rpmF Large ribosomal subunit protein bL32 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q9PQF8 0.000641 36 38 1 54 3 rpmF Large ribosomal subunit protein bL32 Ureaplasma parvum serovar 3 (strain ATCC 700970)
B1AIX2 0.000641 36 38 1 54 3 rpmF Large ribosomal subunit protein bL32 Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736)
Q9PLB2 0.001 36 32 1 55 3 rpmF Large ribosomal subunit protein bL32 Chlamydia muridarum (strain MoPn / Nigg)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_16070
Feature type CDS
Gene rpmF
Product 50S ribosomal protein L32
Location 74566 - 74736 (strand: -1)
Length 171 (nucleotides) / 56 (amino acids)
In genomic island -

Contig

Accession ZDB_532
Length 116685 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2001
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01783 Ribosomal L32p protein family

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0333 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein L32

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02911 large subunit ribosomal protein L32 Ribosome -

Protein Sequence

MAVQQNKPTRSKRGMRRSHDALSATLVSVDKTSGETHLRHHVTADGYYRGRKVINK

Flanking regions ( +/- flanking 50bp)

CGTTTGCCGCATTAGCCAGTTTAAAGAAAAGTACTTAAGGAGTAAGGTCAATGGCCGTACAACAAAATAAACCAACTCGTTCCAAACGTGGTATGCGTCGCTCTCATGACGCACTGTCAGCAACTCTGGTTTCTGTTGACAAAACCTCTGGTGAAACTCATCTGCGCCACCATGTGACCGCTGATGGTTACTACCGTGGTCGTAAGGTAATCAACAAGTAATCTGCTGCTTTTTAAGCACGTTGATATCTTGACTAATCTAACCATCGCGT