Homologs in group_148

Help

9 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_12395 FBDBKF_12395 98.4 Morganella morganii S1 - DUF4222 domain-containing protein
FBDBKF_18715 FBDBKF_18715 100.0 Morganella morganii S1 - DUF4222 domain-containing protein
EHELCC_15290 EHELCC_15290 100.0 Morganella morganii S2 - DUF4222 domain-containing protein
EHELCC_19160 EHELCC_19160 98.4 Morganella morganii S2 - DUF4222 domain-containing protein
NLDBIP_19130 NLDBIP_19130 98.4 Morganella morganii S4 - DUF4222 domain-containing protein
LHKJJB_16020 LHKJJB_16020 100.0 Morganella morganii S3 - DUF4222 domain-containing protein
LHKJJB_19020 LHKJJB_19020 98.4 Morganella morganii S3 - DUF4222 domain-containing protein
HKOGLL_15140 HKOGLL_15140 100.0 Morganella morganii S5 - DUF4222 domain-containing protein
PMI_RS04455 PMI_RS04455 50.0 Proteus mirabilis HI4320 - DUF4222 domain-containing protein

Distribution of the homologs in the orthogroup group_148

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_148

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_15820
Feature type CDS
Gene -
Product DUF4222 domain-containing protein
Location 24775 - 24963 (strand: -1)
Length 189 (nucleotides) / 62 (amino acids)
In genomic island GI1

Contig

Accession ZDB_532
Length 116685 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_148
Orthogroup size 10
N. genomes 6

Actions

Genomic region

Domains

PF13973 Domain of unknown function (DUF4222)

Protein Sequence

MKGTADNLDRYYTDSRGRKVHVVRFDRQNSRVIFMRDGYEHPCFEPLKTFQERYTRVDEVKP

Flanking regions ( +/- flanking 50bp)

TGGGCGGTAGGTGATTTTAACCGTCTGGGTAAGACAGCAGGAGCCTCGGCATGAAAGGAACAGCTGACAATCTGGATCGGTATTACACCGACAGCCGTGGGCGGAAAGTCCACGTTGTCCGGTTTGACCGGCAGAACAGCCGGGTGATTTTCATGCGTGACGGCTATGAGCATCCGTGCTTTGAACCTCTGAAAACCTTTCAGGAGCGGTATACACGCGTGGATGAGGTGAAACCATGAGCATGATTTTAACTGCGCGGGCTTTGCAGATAAAAACCGGCAATGCGCTG