Homologs in group_1738

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11830 FBDBKF_11830 100.0 Morganella morganii S1 yheU YheU family protein
EHELCC_14475 EHELCC_14475 100.0 Morganella morganii S2 yheU YheU family protein
LHKJJB_15040 LHKJJB_15040 100.0 Morganella morganii S3 yheU YheU family protein
HKOGLL_14160 HKOGLL_14160 100.0 Morganella morganii S5 yheU YheU family protein
F4V73_RS14820 F4V73_RS14820 81.9 Morganella psychrotolerans - YheU family protein
PMI_RS13915 PMI_RS13915 63.9 Proteus mirabilis HI4320 - YheU family protein

Distribution of the homologs in the orthogroup group_1738

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1738

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A4WFF7 1.71e-36 119 73 0 72 3 Ent638_3781 UPF0270 protein Ent638_3781 Enterobacter sp. (strain 638)
A7MKK2 5.08e-35 116 70 0 72 3 ESA_04379 UPF0270 protein ESA_04379 Cronobacter sakazakii (strain ATCC BAA-894)
B5XN72 1.35e-34 115 72 0 72 3 KPK_0377 UPF0270 protein KPK_0377 Klebsiella pneumoniae (strain 342)
Q3YWR7 8.36e-34 113 69 0 71 3 yheU UPF0270 protein YheU Shigella sonnei (strain Ss046)
P67627 8.36e-34 113 69 0 71 3 yheU UPF0270 protein YheU Shigella flexneri
Q31VT6 8.36e-34 113 69 0 71 3 yheU UPF0270 protein YheU Shigella boydii serotype 4 (strain Sb227)
B2U3F9 8.36e-34 113 69 0 71 3 yheU UPF0270 protein YheU Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
B1LHF5 8.36e-34 113 69 0 71 3 yheU UPF0270 protein YheU Escherichia coli (strain SMS-3-5 / SECEC)
B6I2R3 8.36e-34 113 69 0 71 3 yheU UPF0270 protein YheU Escherichia coli (strain SE11)
B7NDW3 8.36e-34 113 69 0 71 3 yheU UPF0270 protein YheU Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P67624 8.36e-34 113 69 0 71 3 yheU UPF0270 protein YheU Escherichia coli (strain K12)
B1IPB0 8.36e-34 113 69 0 71 3 yheU UPF0270 protein YheU Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P67625 8.36e-34 113 69 0 71 3 yheU UPF0270 protein YheU Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCA6 8.36e-34 113 69 0 71 3 yheU UPF0270 protein YheU Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A5G2 8.36e-34 113 69 0 71 3 yheU UPF0270 protein YheU Escherichia coli O9:H4 (strain HS)
B1X6K4 8.36e-34 113 69 0 71 3 yheU UPF0270 protein YheU Escherichia coli (strain K12 / DH10B)
C4ZUL0 8.36e-34 113 69 0 71 3 yheU UPF0270 protein YheU Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1Q6 8.36e-34 113 69 0 71 3 yheU UPF0270 protein YheU Escherichia coli O8 (strain IAI1)
B7N0Z1 8.36e-34 113 69 0 71 3 yheU UPF0270 protein YheU Escherichia coli O81 (strain ED1a)
B7NMC2 8.36e-34 113 69 0 71 3 yheU UPF0270 protein YheU Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YTR1 8.36e-34 113 69 0 71 3 yheU UPF0270 protein YheU Escherichia coli O157:H7 (strain EC4115 / EHEC)
P67626 8.36e-34 113 69 0 71 3 yheU UPF0270 protein YheU Escherichia coli O157:H7
B7L4N1 8.36e-34 113 69 0 71 3 yheU UPF0270 protein YheU Escherichia coli (strain 55989 / EAEC)
B7UK65 8.36e-34 113 69 0 71 3 yheU UPF0270 protein YheU Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSN0 8.36e-34 113 69 0 71 3 yheU UPF0270 protein YheU Escherichia coli O139:H28 (strain E24377A / ETEC)
A6TEZ3 9.22e-34 113 70 0 72 3 KPN78578_37030 UPF0270 protein KPN78578_37030 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q1R5S8 2.74e-33 111 67 0 71 3 yheU UPF0270 protein YheU Escherichia coli (strain UTI89 / UPEC)
B7MCX0 2.74e-33 111 67 0 71 3 yheU UPF0270 protein YheU Escherichia coli O45:K1 (strain S88 / ExPEC)
B7LS61 3.22e-33 111 67 0 71 3 yheU UPF0270 protein YheU Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
P0A2P4 6.16e-33 110 69 0 71 3 yheU UPF0270 protein YheU Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2P5 6.16e-33 110 69 0 71 3 yheU UPF0270 protein YheU Salmonella typhi
B4TXG5 6.16e-33 110 69 0 71 3 yheU UPF0270 protein YheU Salmonella schwarzengrund (strain CVM19633)
B5BH08 6.16e-33 110 69 0 71 3 yheU UPF0270 protein YheU Salmonella paratyphi A (strain AKU_12601)
C0Q0D9 6.16e-33 110 69 0 71 3 yheU UPF0270 protein YheU Salmonella paratyphi C (strain RKS4594)
A9MT26 6.16e-33 110 69 0 71 3 yheU UPF0270 protein YheU Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PLV3 6.16e-33 110 69 0 71 3 yheU UPF0270 protein YheU Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUW4 6.16e-33 110 69 0 71 3 yheU UPF0270 protein YheU Salmonella newport (strain SL254)
B4TKN8 6.16e-33 110 69 0 71 3 yheU UPF0270 protein YheU Salmonella heidelberg (strain SL476)
Q57J09 6.16e-33 110 69 0 71 3 yheU UPF0270 protein YheU Salmonella choleraesuis (strain SC-B67)
B5RGZ3 8.29e-33 110 69 0 71 3 yheU UPF0270 protein YheU Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R2B3 8.29e-33 110 69 0 71 3 yheU UPF0270 protein YheU Salmonella enteritidis PT4 (strain P125109)
B5FJN6 8.29e-33 110 69 0 71 3 yheU UPF0270 protein YheU Salmonella dublin (strain CT_02021853)
Q32B11 1.26e-32 110 67 0 71 3 yheU UPF0270 protein YheU Shigella dysenteriae serotype 1 (strain Sd197)
A8GKN0 1.65e-32 110 66 0 72 3 Spro_4577 UPF0270 protein Spro_4577 Serratia proteamaculans (strain 568)
B5F8H5 1.71e-32 109 67 0 71 3 yheU UPF0270 protein YheU Salmonella agona (strain SL483)
C5B954 2.43e-32 109 68 0 72 3 NT01EI_3666 UPF0270 protein NT01EI_3666 Edwardsiella ictaluri (strain 93-146)
A9MN11 3.57e-32 108 66 0 71 3 yheU UPF0270 protein YheU Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
A8AQQ4 1.91e-31 107 66 0 71 3 CKO_04772 UPF0270 protein CKO_04772 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q6CZU0 2.34e-31 107 66 0 72 3 ECA4061 UPF0270 protein ECA4061 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q1CCR5 4.98e-31 106 65 0 72 3 YPN_3888 UPF0270 protein YPN_3888 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R484 4.98e-31 106 65 0 72 3 YpAngola_A3698 UPF0270 protein YpAngola_A3698 Yersinia pestis bv. Antiqua (strain Angola)
Q1C2R7 4.98e-31 106 65 0 72 3 YPA_3293 UPF0270 protein YPA_3293 Yersinia pestis bv. Antiqua (strain Antiqua)
Q8ZJD4 4.98e-31 106 65 0 72 3 YPO0179 UPF0270 protein YPO0179/y3960/YP_0178 Yersinia pestis
A4TGW5 4.98e-31 106 65 0 72 3 YPDSF_0104 UPF0270 protein YPDSF_0104 Yersinia pestis (strain Pestoides F)
B2VK22 9.61e-31 105 65 0 70 3 ETA_31870 UPF0270 protein ETA_31870 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
C6DGA2 1.88e-30 104 68 0 72 3 PC1_3850 UPF0270 protein PC1_3850 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q0SZW2 3.36e-30 103 66 0 71 3 yheU UPF0270 protein YheU Shigella flexneri serotype 5b (strain 8401)
A7FNR1 5.82e-30 103 65 0 70 3 YpsIP31758_3941 UPF0270 protein YpsIP31758_3941 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B2K5Q7 5.82e-30 103 65 0 70 3 YPTS_3917 UPF0270 protein YPTS_3917 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q664P4 5.82e-30 103 65 0 70 3 YPTB3725 UPF0270 protein YPTB3725 Yersinia pseudotuberculosis serotype I (strain IP32953)
B1JIT3 5.82e-30 103 65 0 70 3 YPK_0255 UPF0270 protein YPK_0255 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
B4EZ57 9.48e-30 102 64 0 71 3 PMI2817 UPF0270 protein PMI2817 Proteus mirabilis (strain HI4320)
A1JS94 2.5e-29 102 63 0 72 3 YE3952 UPF0270 protein YE3952 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
Q2NQK2 2.24e-28 99 63 0 71 3 SG2298 UPF0270 protein SG2298 Sodalis glossinidius (strain morsitans)
Q7N9E2 1.64e-27 97 61 0 72 3 plu0398 UPF0270 protein plu0398 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A0KGZ0 9.08e-25 90 61 0 68 3 AHA_0994 UPF0270 protein AHA_0994 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q87L25 9.32e-25 90 61 0 70 3 VP2791 UPF0270 protein VP2791 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
B6EPM6 1.26e-24 90 59 0 71 3 VSAL_I0295 UPF0270 protein VSAL_I0295 Aliivibrio salmonicida (strain LFI1238)
A7MX95 3.97e-24 88 60 0 70 3 VIBHAR_00073 UPF0270 protein VIBHAR_00073 Vibrio campbellii (strain ATCC BAA-1116)
A4SQW5 6.46e-24 88 60 0 70 3 ASA_3305 UPF0270 protein ASA_3305 Aeromonas salmonicida (strain A449)
B7VLH8 2.79e-23 86 57 0 70 3 VS_2853 UPF0270 protein VS_2853 Vibrio atlanticus (strain LGP32)
Q9KNW8 3.54e-23 86 62 0 64 3 VC_2612 UPF0270 protein VC_2612 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
C3LRS3 3.54e-23 86 62 0 64 3 VCM66_2532 UPF0270 protein VCM66_2532 Vibrio cholerae serotype O1 (strain M66-2)
B5FFY9 4.86e-23 86 57 0 71 3 VFMJ11_0205 UPF0270 protein VFMJ11_0205 Aliivibrio fischeri (strain MJ11)
P44954 1.76e-22 84 57 0 70 3 HI_0956 UPF0270 protein HI_0956 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UDB2 1.76e-22 84 57 0 70 3 CGSHiEE_07180 UPF0270 protein CGSHiEE_07180 Haemophilus influenzae (strain PittEE)
Q4QLV1 1.76e-22 84 57 0 70 3 NTHI1129 UPF0270 protein NTHI1129 Haemophilus influenzae (strain 86-028NP)
Q7MH24 4.84e-22 83 52 0 70 3 VV3048 UPF0270 protein VV3048 Vibrio vulnificus (strain YJ016)
Q8DCS6 4.84e-22 83 52 0 70 3 VV1_1320 UPF0270 protein VV1_1320 Vibrio vulnificus (strain CMCP6)
Q9CLQ8 6.94e-21 80 57 0 64 3 PM1156 UPF0270 protein PM1156 Pasteurella multocida (strain Pm70)
Q5QW88 1.01e-20 80 52 0 72 3 IL0325 UPF0270 protein IL0325 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
Q48LG4 2.63e-05 41 38 1 55 3 PSPPH_1506 UPF0270 protein PSPPH_1506 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q886E9 2.94e-05 40 38 1 55 3 PSPTO_1630 UPF0270 protein PSPTO_1630 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
A4VJH6 0.000259 38 37 1 56 3 PST_1436 UPF0270 protein PST_1436 Stutzerimonas stutzeri (strain A1501)
Q4K8K5 0.000375 38 35 1 65 3 PFL_4336 UPF0270 protein PFL_4336 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
C1DQL3 0.000507 37 38 1 55 3 Avin_35000 UPF0270 protein Avin_35000 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q9HYE3 0.000642 37 33 1 65 1 PA3463 UPF0270 protein PA3463 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02QV2 0.000642 37 33 1 65 3 PA14_19330 UPF0270 protein PA14_19330 Pseudomonas aeruginosa (strain UCBPP-PA14)
A6V1W3 0.000642 37 33 1 65 3 PSPA7_1664 UPF0270 protein PSPA7_1664 Pseudomonas aeruginosa (strain PA7)
B7UYN4 0.000642 37 33 1 65 3 PLES_15971 UPF0270 protein PLES_15971 Pseudomonas aeruginosa (strain LESB58)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_15570
Feature type CDS
Gene yheU
Product YheU family protein
Location 120762 - 120980 (strand: -1)
Length 219 (nucleotides) / 72 (amino acids)
In genomic island -

Contig

Accession ZDB_531
Length 138641 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1738
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06794 Uncharacterised protein family (UPF0270)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3089 Function unknown (S) S Uncharacterized conserved protein YheU, UPF0270 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09898 uncharacterized protein - -

Protein Sequence

MIIPWQDIAPETLESILESVVLREGTDYGEHEKSLSDKVADLYTQLKNGDIVIVWSELHETLNIMPSAQFRG

Flanking regions ( +/- flanking 50bp)

GAGCGCATCCCTGAATGGCTCGCGCCGCATCTGGCCGCAAAGGAGACACCATGATTATTCCCTGGCAGGATATCGCGCCGGAAACACTGGAAAGTATCCTGGAAAGTGTGGTGCTGCGCGAAGGCACCGACTACGGCGAACATGAAAAATCACTCAGTGATAAAGTGGCGGATCTTTACACGCAACTCAAAAACGGCGACATTGTGATTGTCTGGTCGGAATTACACGAAACACTCAACATCATGCCGTCGGCGCAATTCCGCGGCTGATTCAGCCGGAGGAAACGCCGCATGTCACGGACCCACCCGATTATCGCCGT