Homologs in group_1738

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_11830 FBDBKF_11830 81.9 Morganella morganii S1 yheU YheU family protein
EHELCC_14475 EHELCC_14475 81.9 Morganella morganii S2 yheU YheU family protein
NLDBIP_15570 NLDBIP_15570 81.9 Morganella morganii S4 yheU YheU family protein
LHKJJB_15040 LHKJJB_15040 81.9 Morganella morganii S3 yheU YheU family protein
HKOGLL_14160 HKOGLL_14160 81.9 Morganella morganii S5 yheU YheU family protein
PMI_RS13915 PMI_RS13915 63.9 Proteus mirabilis HI4320 - YheU family protein

Distribution of the homologs in the orthogroup group_1738

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1738

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
A6TEZ3 8.09e-34 113 70 0 72 3 KPN78578_37030 UPF0270 protein KPN78578_37030 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5XN72 4.39e-33 111 69 0 72 3 KPK_0377 UPF0270 protein KPK_0377 Klebsiella pneumoniae (strain 342)
Q1CCR5 3.9e-32 108 65 0 72 3 YPN_3888 UPF0270 protein YPN_3888 Yersinia pestis bv. Antiqua (strain Nepal516)
A9R484 3.9e-32 108 65 0 72 3 YpAngola_A3698 UPF0270 protein YpAngola_A3698 Yersinia pestis bv. Antiqua (strain Angola)
Q1C2R7 3.9e-32 108 65 0 72 3 YPA_3293 UPF0270 protein YPA_3293 Yersinia pestis bv. Antiqua (strain Antiqua)
Q8ZJD4 3.9e-32 108 65 0 72 3 YPO0179 UPF0270 protein YPO0179/y3960/YP_0178 Yersinia pestis
A4TGW5 3.9e-32 108 65 0 72 3 YPDSF_0104 UPF0270 protein YPDSF_0104 Yersinia pestis (strain Pestoides F)
A8GKN0 1.91e-31 107 63 0 72 3 Spro_4577 UPF0270 protein Spro_4577 Serratia proteamaculans (strain 568)
A7MKK2 2.55e-31 107 65 0 72 3 ESA_04379 UPF0270 protein ESA_04379 Cronobacter sakazakii (strain ATCC BAA-894)
A7FNR1 3.39e-31 106 63 0 72 3 YpsIP31758_3941 UPF0270 protein YpsIP31758_3941 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
B2K5Q7 3.39e-31 106 63 0 72 3 YPTS_3917 UPF0270 protein YPTS_3917 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q664P4 3.39e-31 106 63 0 72 3 YPTB3725 UPF0270 protein YPTB3725 Yersinia pseudotuberculosis serotype I (strain IP32953)
B1JIT3 3.39e-31 106 63 0 72 3 YPK_0255 UPF0270 protein YPK_0255 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
A1JS94 4.51e-31 106 65 0 72 3 YE3952 UPF0270 protein YE3952 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A4WFF7 7.72e-31 105 63 0 72 3 Ent638_3781 UPF0270 protein Ent638_3781 Enterobacter sp. (strain 638)
C6DGA2 1.58e-30 105 70 0 70 3 PC1_3850 UPF0270 protein PC1_3850 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
B7LS61 3.59e-30 103 63 0 71 3 yheU UPF0270 protein YheU Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
A8AQQ4 3.59e-30 103 64 0 71 3 CKO_04772 UPF0270 protein CKO_04772 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
Q6CZU0 6.01e-30 103 65 0 70 3 ECA4061 UPF0270 protein ECA4061 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
Q1R5S8 9.02e-30 102 61 0 71 3 yheU UPF0270 protein YheU Escherichia coli (strain UTI89 / UPEC)
B7MCX0 9.02e-30 102 61 0 71 3 yheU UPF0270 protein YheU Escherichia coli O45:K1 (strain S88 / ExPEC)
Q3YWR7 1.38e-29 102 61 0 71 3 yheU UPF0270 protein YheU Shigella sonnei (strain Ss046)
P67627 1.38e-29 102 61 0 71 3 yheU UPF0270 protein YheU Shigella flexneri
Q31VT6 1.38e-29 102 61 0 71 3 yheU UPF0270 protein YheU Shigella boydii serotype 4 (strain Sb227)
B2U3F9 1.38e-29 102 61 0 71 3 yheU UPF0270 protein YheU Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P0A2P4 1.38e-29 102 64 0 71 3 yheU UPF0270 protein YheU Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P0A2P5 1.38e-29 102 64 0 71 3 yheU UPF0270 protein YheU Salmonella typhi
B4TXG5 1.38e-29 102 64 0 71 3 yheU UPF0270 protein YheU Salmonella schwarzengrund (strain CVM19633)
B5BH08 1.38e-29 102 64 0 71 3 yheU UPF0270 protein YheU Salmonella paratyphi A (strain AKU_12601)
C0Q0D9 1.38e-29 102 64 0 71 3 yheU UPF0270 protein YheU Salmonella paratyphi C (strain RKS4594)
A9MT26 1.38e-29 102 64 0 71 3 yheU UPF0270 protein YheU Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PLV3 1.38e-29 102 64 0 71 3 yheU UPF0270 protein YheU Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4SUW4 1.38e-29 102 64 0 71 3 yheU UPF0270 protein YheU Salmonella newport (strain SL254)
B4TKN8 1.38e-29 102 64 0 71 3 yheU UPF0270 protein YheU Salmonella heidelberg (strain SL476)
Q57J09 1.38e-29 102 64 0 71 3 yheU UPF0270 protein YheU Salmonella choleraesuis (strain SC-B67)
B1LHF5 1.38e-29 102 61 0 71 3 yheU UPF0270 protein YheU Escherichia coli (strain SMS-3-5 / SECEC)
B6I2R3 1.38e-29 102 61 0 71 3 yheU UPF0270 protein YheU Escherichia coli (strain SE11)
B7NDW3 1.38e-29 102 61 0 71 3 yheU UPF0270 protein YheU Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P67624 1.38e-29 102 61 0 71 3 yheU UPF0270 protein YheU Escherichia coli (strain K12)
B1IPB0 1.38e-29 102 61 0 71 3 yheU UPF0270 protein YheU Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P67625 1.38e-29 102 61 0 71 3 yheU UPF0270 protein YheU Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TCA6 1.38e-29 102 61 0 71 3 yheU UPF0270 protein YheU Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A5G2 1.38e-29 102 61 0 71 3 yheU UPF0270 protein YheU Escherichia coli O9:H4 (strain HS)
B1X6K4 1.38e-29 102 61 0 71 3 yheU UPF0270 protein YheU Escherichia coli (strain K12 / DH10B)
C4ZUL0 1.38e-29 102 61 0 71 3 yheU UPF0270 protein YheU Escherichia coli (strain K12 / MC4100 / BW2952)
B7M1Q6 1.38e-29 102 61 0 71 3 yheU UPF0270 protein YheU Escherichia coli O8 (strain IAI1)
B7N0Z1 1.38e-29 102 61 0 71 3 yheU UPF0270 protein YheU Escherichia coli O81 (strain ED1a)
B7NMC2 1.38e-29 102 61 0 71 3 yheU UPF0270 protein YheU Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5YTR1 1.38e-29 102 61 0 71 3 yheU UPF0270 protein YheU Escherichia coli O157:H7 (strain EC4115 / EHEC)
P67626 1.38e-29 102 61 0 71 3 yheU UPF0270 protein YheU Escherichia coli O157:H7
B7L4N1 1.38e-29 102 61 0 71 3 yheU UPF0270 protein YheU Escherichia coli (strain 55989 / EAEC)
B7UK65 1.38e-29 102 61 0 71 3 yheU UPF0270 protein YheU Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZSN0 1.38e-29 102 61 0 71 3 yheU UPF0270 protein YheU Escherichia coli O139:H28 (strain E24377A / ETEC)
A9MN11 1.67e-29 102 63 0 71 3 yheU UPF0270 protein YheU Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B4EZ57 1.75e-29 102 64 0 71 3 PMI2817 UPF0270 protein PMI2817 Proteus mirabilis (strain HI4320)
B2VK22 2.29e-29 102 62 0 70 3 ETA_31870 UPF0270 protein ETA_31870 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
B5F8H5 3.84e-29 101 63 0 71 3 yheU UPF0270 protein YheU Salmonella agona (strain SL483)
Q2NQK2 5.8e-29 100 63 0 71 3 SG2298 UPF0270 protein SG2298 Sodalis glossinidius (strain morsitans)
B5RGZ3 6.36e-29 100 64 0 71 3 yheU UPF0270 protein YheU Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R2B3 6.36e-29 100 64 0 71 3 yheU UPF0270 protein YheU Salmonella enteritidis PT4 (strain P125109)
B5FJN6 6.36e-29 100 64 0 71 3 yheU UPF0270 protein YheU Salmonella dublin (strain CT_02021853)
C5B954 6.5e-29 100 62 0 72 3 NT01EI_3666 UPF0270 protein NT01EI_3666 Edwardsiella ictaluri (strain 93-146)
Q32B11 3.23e-28 99 60 0 71 3 yheU UPF0270 protein YheU Shigella dysenteriae serotype 1 (strain Sd197)
Q0SZW2 2.36e-26 94 60 0 71 3 yheU UPF0270 protein YheU Shigella flexneri serotype 5b (strain 8401)
A0KGZ0 5.92e-26 93 63 0 68 3 AHA_0994 UPF0270 protein AHA_0994 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q7N9E2 7.46e-26 93 56 0 72 3 plu0398 UPF0270 protein plu0398 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A4SQW5 6.32e-25 90 60 0 70 3 ASA_3305 UPF0270 protein ASA_3305 Aeromonas salmonicida (strain A449)
Q5QW88 4.17e-23 86 58 0 72 3 IL0325 UPF0270 protein IL0325 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
P44954 1.76e-22 84 58 0 70 3 HI_0956 UPF0270 protein HI_0956 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UDB2 1.76e-22 84 58 0 70 3 CGSHiEE_07180 UPF0270 protein CGSHiEE_07180 Haemophilus influenzae (strain PittEE)
Q4QLV1 1.76e-22 84 58 0 70 3 NTHI1129 UPF0270 protein NTHI1129 Haemophilus influenzae (strain 86-028NP)
A7MX95 9.66e-22 82 55 0 70 3 VIBHAR_00073 UPF0270 protein VIBHAR_00073 Vibrio campbellii (strain ATCC BAA-1116)
Q87L25 1.39e-21 82 55 0 70 3 VP2791 UPF0270 protein VP2791 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
Q9CLQ8 1.51e-21 82 59 0 64 3 PM1156 UPF0270 protein PM1156 Pasteurella multocida (strain Pm70)
B7VLH8 2.13e-21 81 52 0 70 3 VS_2853 UPF0270 protein VS_2853 Vibrio atlanticus (strain LGP32)
Q9KNW8 1.09e-20 80 57 0 64 3 VC_2612 UPF0270 protein VC_2612 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
C3LRS3 1.09e-20 80 57 0 64 3 VCM66_2532 UPF0270 protein VCM66_2532 Vibrio cholerae serotype O1 (strain M66-2)
B5FFY9 1.85e-20 79 55 0 70 3 VFMJ11_0205 UPF0270 protein VFMJ11_0205 Aliivibrio fischeri (strain MJ11)
Q7MH24 2.17e-20 79 51 0 70 3 VV3048 UPF0270 protein VV3048 Vibrio vulnificus (strain YJ016)
Q8DCS6 2.17e-20 79 51 0 70 3 VV1_1320 UPF0270 protein VV1_1320 Vibrio vulnificus (strain CMCP6)
B6EPM6 2.86e-20 79 54 0 70 3 VSAL_I0295 UPF0270 protein VSAL_I0295 Aliivibrio salmonicida (strain LFI1238)
Q9HYE3 9.08e-07 45 37 1 69 1 PA3463 UPF0270 protein PA3463 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02QV2 9.08e-07 45 37 1 69 3 PA14_19330 UPF0270 protein PA14_19330 Pseudomonas aeruginosa (strain UCBPP-PA14)
A6V1W3 9.08e-07 45 37 1 69 3 PSPA7_1664 UPF0270 protein PSPA7_1664 Pseudomonas aeruginosa (strain PA7)
B7UYN4 9.08e-07 45 37 1 69 3 PLES_15971 UPF0270 protein PLES_15971 Pseudomonas aeruginosa (strain LESB58)
C1DQL3 1.5e-05 41 40 1 55 3 Avin_35000 UPF0270 protein Avin_35000 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
Q4K8K5 2.44e-05 41 35 1 65 3 PFL_4336 UPF0270 protein PFL_4336 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
A4VJH6 2.52e-05 41 37 1 56 3 PST_1436 UPF0270 protein PST_1436 Stutzerimonas stutzeri (strain A1501)
Q886E9 2.61e-05 41 35 1 56 3 PSPTO_1630 UPF0270 protein PSPTO_1630 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q48LG4 2.61e-05 41 35 1 56 3 PSPPH_1506 UPF0270 protein PSPPH_1506 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q1IDC3 0.000125 39 32 1 56 3 PSEEN1465 UPF0270 protein PSEEN1465 Pseudomonas entomophila (strain L48)
B0KTV7 0.000127 39 32 1 55 3 PputGB1_1339 UPF0270 protein PputGB1_1339 Pseudomonas putida (strain GB-1)
C3K071 0.000238 38 30 1 65 3 PFLU_4323 UPF0270 protein PFLU_4323 Pseudomonas fluorescens (strain SBW25)
Q3K8R4 0.00024 38 30 1 65 3 Pfl01_4103 UPF0270 protein Pfl01_4103 Pseudomonas fluorescens (strain Pf0-1)
A5W7I1 0.00028 38 32 1 55 3 Pput_3967 UPF0270 protein Pput_3967 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q88M28 0.00028 38 32 1 55 3 PP_1747 UPF0270 protein PP_1747 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)

  • Number of RefSeq hits:

General

Source Morganella psychrotolerans
Locus tag F4V73_RS14820
Feature type CDS
Gene -
Product YheU family protein
Location 199770 - 199988 (strand: -1)
Length 219 (nucleotides) / 72 (amino acids)
In genomic island -

Contig

Accession NZ_VXKB01000004
Length 258164 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1738
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF06794 Uncharacterised protein family (UPF0270)

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3089 Function unknown (S) S Uncharacterized conserved protein YheU, UPF0270 family

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K09898 uncharacterized protein - -

Protein Sequence

MIIPWQEIDAQTLQNILESIVLREGTDYGEYEKSLSDKVTDLCNQLKNGEIVIVWSELHETLNIMPSAEFRG

Flanking regions ( +/- flanking 50bp)

GAACGCATACCTGAGTGGCTGGCGCCTCATCTGGCGGCAAAGGATACAAAATGATTATTCCCTGGCAGGAGATTGATGCACAAACATTGCAAAATATCCTGGAAAGTATTGTATTGCGCGAAGGCACCGATTACGGTGAATATGAGAAGTCACTCAGTGATAAAGTGACTGACCTGTGCAACCAACTGAAAAACGGCGAGATTGTGATTGTCTGGTCGGAATTACACGAAACACTCAATATCATGCCGTCGGCGGAATTCCGCGGCTGATACGCCCGGAGGAACTGACCCATGTCCCGGACTCACCCGATTATTGCTGT