Homologs in group_2851

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10675 FBDBKF_10675 100.0 Morganella morganii S1 rhtB Threonine/homoserine/homoserine lactone efflux protein
EHELCC_15010 EHELCC_15010 100.0 Morganella morganii S2 rhtB Threonine/homoserine/homoserine lactone efflux protein
LHKJJB_14505 LHKJJB_14505 100.0 Morganella morganii S3 rhtB Threonine/homoserine/homoserine lactone efflux protein
HKOGLL_13125 HKOGLL_13125 100.0 Morganella morganii S5 rhtB Threonine/homoserine/homoserine lactone efflux protein
F4V73_RS14390 F4V73_RS14390 88.6 Morganella psychrotolerans - LysE family translocator

Distribution of the homologs in the orthogroup group_2851

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2851

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
P0AG37 7.57e-14 70 28 3 173 3 rhtB Homoserine/homoserine lactone efflux protein Shigella flexneri
P0AG34 7.57e-14 70 28 3 173 1 rhtB Homoserine/homoserine lactone efflux protein Escherichia coli (strain K12)
P0AG35 7.57e-14 70 28 3 173 3 rhtB Homoserine/homoserine lactone efflux protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
P0AG36 7.57e-14 70 28 3 173 3 rhtB Homoserine/homoserine lactone efflux protein Escherichia coli O157:H7
A6T7N0 1.84e-13 69 30 5 209 3 leuE Leucine efflux protein Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
Q1RAZ2 1.99e-13 69 26 0 192 3 leuE Leucine efflux protein Escherichia coli (strain UTI89 / UPEC)
Q8FGV4 1.99e-13 69 26 0 192 3 leuE Leucine efflux protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TH31 1.99e-13 69 26 0 192 3 leuE Leucine efflux protein Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1ABX2 1.99e-13 69 26 0 192 3 leuE Leucine efflux protein Escherichia coli O1:K1 / APEC
Q32FT6 2.55e-13 69 26 0 192 3 leuE Leucine efflux protein Shigella dysenteriae serotype 1 (strain Sd197)
Q3Z2D8 3.79e-13 68 26 3 198 3 leuE Leucine efflux protein Shigella sonnei (strain Ss046)
A7ZMR9 3.79e-13 68 26 3 198 3 leuE Leucine efflux protein Escherichia coli O139:H28 (strain E24377A / ETEC)
Q8XDS6 6.65e-13 68 26 3 198 3 leuE Leucine efflux protein Escherichia coli O157:H7
A8AHJ0 7.07e-13 68 27 0 192 3 leuE Leucine efflux protein Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
P76249 1.53e-12 67 25 0 192 1 leuE Leucine efflux protein Escherichia coli (strain K12)
A8A0Z3 1.53e-12 67 25 0 192 3 leuE Leucine efflux protein Escherichia coli O9:H4 (strain HS)
Q9L6N6 1.66e-12 67 29 3 162 3 rhtB Homoserine/homoserine lactone efflux protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
P75693 2.22e-12 67 31 1 118 3 yahN Uncharacterized membrane protein YahN Escherichia coli (strain K12)
Q8Z3B4 2.63e-12 66 29 3 162 3 rhtB Homoserine/homoserine lactone efflux protein Salmonella typhi
Q321T8 2.83e-12 65 25 3 193 5 leuE Putative leucine efflux protein Shigella boydii serotype 4 (strain Sb227)
O05406 2.94e-12 66 23 4 214 3 yrhP Uncharacterized membrane protein YrhP Bacillus subtilis (strain 168)
Q7CQP8 3.49e-12 66 27 3 196 3 leuE Leucine efflux protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8XEV9 3.49e-12 66 27 3 196 3 leuE Leucine efflux protein Salmonella typhi
Q5PHF4 3.49e-12 66 27 3 196 3 leuE Leucine efflux protein Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q57Q25 3.49e-12 66 27 3 196 3 leuE Leucine efflux protein Salmonella choleraesuis (strain SC-B67)
P38102 7.51e-12 65 29 3 170 3 PA4757 Uncharacterized membrane protein PA4757 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
A4WB82 4.87e-11 63 28 2 195 3 leuE Leucine efflux protein Enterobacter sp. (strain 638)
Q9KVK7 2.65e-07 52 28 2 142 3 VC_0136 Uncharacterized membrane protein VC_0136 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Q1R8F4 8.04e-07 51 32 4 138 3 eamB Cysteine/O-acetylserine efflux protein Escherichia coli (strain UTI89 / UPEC)
Q8FF11 8.04e-07 51 32 4 138 3 eamB Cysteine/O-acetylserine efflux protein Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0TER0 8.04e-07 51 32 4 138 3 eamB Cysteine/O-acetylserine efflux protein Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A1AEA8 8.04e-07 51 32 4 138 3 eamB Cysteine/O-acetylserine efflux protein Escherichia coli O1:K1 / APEC
Q3YYT7 1.22e-06 50 32 4 138 3 eamB Cysteine/O-acetylserine efflux protein Shigella sonnei (strain Ss046)
P38101 1.22e-06 50 32 4 138 1 eamB Cysteine/O-acetylserine efflux protein Escherichia coli (strain K12)
A8A390 1.22e-06 50 32 4 138 3 eamB Cysteine/O-acetylserine efflux protein Escherichia coli O9:H4 (strain HS)
A7ZQ23 1.24e-06 50 32 4 138 3 eamB Cysteine/O-acetylserine efflux protein Escherichia coli O139:H28 (strain E24377A / ETEC)
Q83K22 1.47e-06 50 33 4 124 3 eamB Cysteine/O-acetylserine efflux protein Shigella flexneri
Q0T1S8 1.47e-06 50 33 4 124 3 eamB Cysteine/O-acetylserine efflux protein Shigella flexneri serotype 5b (strain 8401)
Q8XA19 3.73e-06 49 31 4 138 3 eamB Cysteine/O-acetylserine efflux protein Escherichia coli O157:H7
Q9L6N7 7.92e-06 48 20 2 136 3 rhtC Threonine efflux protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q8Z3B3 9.15e-06 48 20 2 136 3 rhtC Threonine efflux protein Salmonella typhi
P0AG38 1.06e-05 48 20 2 158 1 rhtC Threonine efflux protein Escherichia coli (strain K12)
P0AG39 1.06e-05 48 20 2 158 3 rhtC Threonine efflux protein Escherichia coli O157:H7
Q8ZMX5 1.16e-05 47 31 3 125 3 eamB Cysteine/O-acetylserine efflux protein Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
Q57L56 1.16e-05 47 31 3 125 3 eamB Cysteine/O-acetylserine efflux protein Salmonella choleraesuis (strain SC-B67)
Q8Z4J7 1.29e-05 47 31 3 125 3 eamB Cysteine/O-acetylserine efflux protein Salmonella typhi
Q5PNB4 1.29e-05 47 31 3 125 3 eamB Cysteine/O-acetylserine efflux protein Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Q31XQ6 1.42e-05 47 31 4 138 3 eamB Cysteine/O-acetylserine efflux protein Shigella boydii serotype 4 (strain Sb227)
Q57320 4.04e-05 46 23 1 139 3 HI_1307 Uncharacterized membrane protein HI_1307 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A6T515 0.00023 43 32 5 131 3 eamB Cysteine/O-acetylserine efflux protein Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_14840
Feature type CDS
Gene rhtB
Product Threonine/homoserine/homoserine lactone efflux protein
Location 103148 - 103780 (strand: 1)
Length 633 (nucleotides) / 210 (amino acids)

Contig

Accession ZDB_530
Length 141725 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2851
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF01810 LysE type translocator

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG1280 Amino acid transport and metabolism (E) E Threonine/homoserine/homoserine lactone efflux protein

Protein Sequence

MPDLTSLLGFALVALGMVLTPGPNMIYLISRSLCQGKRAGYISLAGVGLAFIFYMLSAAFGITALFFAVPYAYDALRIAGALYLLWLAWQSVKPGGRSAFSVRDLPEDKPKKLFTMGFLTSLANPKVAVMYLSLLPQFIVPGHGSVLVQSLALGTIQIMISLTVNGLIILMAGSVAVFMTGRPFWQVVQRWLMGTVLAGLAVRMALESRR

Flanking regions ( +/- flanking 50bp)

CAATAATCTATCTTATAATCTGTTATGCATTATCTGTCATGGAGTGCATTATGCCTGATTTGACGTCATTGCTCGGATTTGCCCTGGTTGCACTGGGAATGGTATTAACGCCCGGCCCTAATATGATTTATCTGATCTCCCGTTCCCTCTGTCAGGGAAAGCGGGCAGGATATATTTCTCTTGCCGGTGTCGGTCTGGCATTTATTTTTTATATGCTCAGTGCGGCATTTGGTATCACAGCGCTCTTTTTTGCCGTTCCTTACGCCTATGACGCTCTGCGTATCGCGGGAGCATTATATTTGCTCTGGCTGGCGTGGCAGTCGGTCAAACCGGGCGGACGCTCTGCATTTTCGGTGCGGGATTTACCGGAAGATAAGCCGAAAAAATTGTTCACCATGGGGTTTTTGACCAGCCTGGCGAACCCGAAAGTGGCGGTGATGTATTTATCGCTGCTGCCGCAGTTTATTGTACCGGGGCACGGCAGTGTGCTGGTGCAGTCTCTGGCGCTCGGAACAATACAGATTATGATCAGCCTGACAGTTAACGGACTGATTATTCTGATGGCGGGCTCGGTGGCTGTCTTTATGACGGGCCGTCCGTTCTGGCAGGTGGTGCAGCGCTGGCTGATGGGGACTGTGCTGGCCGGGCTGGCTGTCCGGATGGCGCTGGAATCCCGGCGCTGAGGCGATAAAAAAAGACCGGCTTTTTGAGCCGGTCTGTTTCGTTTCCGTTA