Homologs in group_2842

Help

5 homologs were identified in 5 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_10550 FBDBKF_10550 100.0 Morganella morganii S1 dctM TRAP-type C4-dicarboxylate transport system, small permease component YiaM
EHELCC_14885 EHELCC_14885 100.0 Morganella morganii S2 dctM TRAP-type C4-dicarboxylate transport system, small permease component YiaM
LHKJJB_14630 LHKJJB_14630 100.0 Morganella morganii S3 dctM TRAP-type C4-dicarboxylate transport system, small permease component YiaM
HKOGLL_13250 HKOGLL_13250 100.0 Morganella morganii S5 dctM TRAP-type C4-dicarboxylate transport system, small permease component YiaM
F4V73_RS14260 F4V73_RS14260 91.0 Morganella psychrotolerans - TRAP transporter small permease

Distribution of the homologs in the orthogroup group_2842

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_2842

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q9KR65 2.54e-11 62 28 1 140 1 siaQ Sialic acid TRAP transporter small permease protein SiaQ Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
P44994 1.39e-10 59 36 0 79 3 HI_1030 Putative TRAP transporter small permease protein HI_1030 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
P37674 1.63e-07 51 29 4 137 1 yiaM 2,3-diketo-L-gulonate TRAP transporter small permease protein YiaM Escherichia coli (strain K12)
Q4QP40 1.15e-06 50 25 1 114 3 siaT Sialic acid TRAP transporter permease protein SiaT Haemophilus influenzae (strain 86-028NP)
P44543 1.89e-06 50 25 1 114 1 siaT Sialic acid TRAP transporter permease protein SiaT Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
O07837 9.93e-06 47 30 1 113 1 dctQ C4-dicarboxylate TRAP transporter small permease protein DctQ Rhodobacter capsulatus
Q4TVS0 3.28e-05 46 23 1 114 3 siaT Sialic acid TRAP transporter permease protein SiaT Haemophilus influenzae
Q312S1 9e-05 45 26 4 135 1 dctMQ Isethionate TRAP transporter permease protein DctMQ Oleidesulfovibrio alaskensis (strain ATCC BAA-1058 / DSM 17464 / G20)
P44484 0.0006 42 22 3 155 3 HI_0051 Putative TRAP transporter small permease protein HI_0051 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_14715
Feature type CDS
Gene dctM
Product TRAP-type C4-dicarboxylate transport system, small permease component YiaM
Location 69175 - 69678 (strand: 1)
Length 504 (nucleotides) / 167 (amino acids)

Contig

Accession ZDB_530
Length 141725 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_2842
Orthogroup size 6
N. genomes 6

Actions

Genomic region

Domains

PF04290 Tripartite ATP-independent periplasmic transporters, DctQ component

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG3090 Carbohydrate transport and metabolism (G) G TRAP-type C4-dicarboxylate transport system, small permease component YiaM

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K21394 TRAP-type transport system small permease protein - -

Protein Sequence

MKNLVALINKGLAVFTICLSAFLVFCVTWQVLSRYILSSPSTITDELARYLFMWVAMIGAAYTTGQHRHLAIDLLVMKLSGARKQFVSLFIQIAIIAFAGIVLVYGGSTLVSSTLESGQITPALGWQMGYIYLCLPISGLLMIMYALVDIFSLFQPGSANTELTDSH

Flanking regions ( +/- flanking 50bp)

TGTGACAGTTGCCAAATTGGTTAACCAAAATAAGAACAAGGACAAGGCCAATGAAAAACCTTGTAGCGCTGATTAATAAAGGGCTTGCTGTTTTTACTATCTGTTTATCAGCATTCCTGGTGTTCTGTGTGACATGGCAGGTGTTATCCCGCTATATCCTCAGCTCCCCGAGTACCATTACTGATGAACTCGCCCGTTACCTTTTTATGTGGGTCGCCATGATTGGTGCGGCTTACACCACAGGACAACACCGGCACCTCGCGATTGATCTTCTCGTTATGAAACTGTCAGGTGCAAGAAAGCAGTTTGTCAGTTTATTTATCCAGATTGCCATTATTGCCTTTGCAGGCATTGTGCTGGTGTACGGCGGCAGCACACTGGTTTCTTCCACACTGGAAAGCGGTCAGATCACCCCGGCACTGGGCTGGCAGATGGGTTACATCTATCTCTGTTTACCAATCAGCGGCTTACTGATGATTATGTATGCACTGGTTGATATCTTTTCACTCTTTCAGCCGGGTTCAGCAAATACTGAACTGACTGACAGCCATTAATGGTGCGATGAGAGGTTAATTATGGATTGGTATGTGATTGCCGCGCTCTT