Homologs in group_1430

Help

6 homologs were identified in 6 genomes with OrthoFinder.
The following table displays the locus tag of each homolog, the organism to which it belongs, the gene name and product.

Locus tag Identity Source Gene Product
FBDBKF_08500 FBDBKF_08500 100.0 Morganella morganii S1 rpsR 30S ribosomal protein S18
EHELCC_13025 EHELCC_13025 100.0 Morganella morganii S2 rpsR 30S ribosomal protein S18
LHKJJB_13190 LHKJJB_13190 100.0 Morganella morganii S3 rpsR 30S ribosomal protein S18
HKOGLL_11840 HKOGLL_11840 100.0 Morganella morganii S5 rpsR 30S ribosomal protein S18
F4V73_RS09725 F4V73_RS09725 100.0 Morganella psychrotolerans rpsR 30S ribosomal protein S18
PMI_RS16800 PMI_RS16800 98.7 Proteus mirabilis HI4320 rpsR 30S ribosomal protein S18

Distribution of the homologs in the orthogroup group_1430

Help

Number of homologs in each genome (first column) and amino-acid identity of the closest homolog (second column).

Download SVG

Phylogeny of the RefSeq best hits of group_1430

Swissprot accession Eval Score ID (%) N gaps Alignment length Annot score Gene Description Organism
Q3YUE5 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Shigella sonnei (strain Ss046)
P0A7U2 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Shigella flexneri
Q0SX84 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Shigella flexneri serotype 5b (strain 8401)
Q328J7 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Shigella dysenteriae serotype 1 (strain Sd197)
Q31TD3 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Shigella boydii serotype 4 (strain Sb227)
B2TY75 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Shigella boydii serotype 18 (strain CDC 3083-94 / BS512)
P0A7U1 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Salmonella typhi
B4TT35 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Salmonella schwarzengrund (strain CVM19633)
B5BKL1 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Salmonella paratyphi A (strain AKU_12601)
C0Q6G0 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Salmonella paratyphi C (strain RKS4594)
A9N520 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)
Q5PJ56 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Salmonella paratyphi A (strain ATCC 9150 / SARB42)
B4T3F3 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Salmonella newport (strain SL254)
B4TFD7 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Salmonella heidelberg (strain SL476)
B5R9F0 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Salmonella gallinarum (strain 287/91 / NCTC 13346)
B5R0S0 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Salmonella enteritidis PT4 (strain P125109)
B5FSA3 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Salmonella dublin (strain CT_02021853)
Q57GI9 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Salmonella choleraesuis (strain SC-B67)
A9MFK9 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)
B5F3B9 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Salmonella agona (strain SL483)
B4F277 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Proteus mirabilis (strain HI4320)
P0A7U0 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)
A6THB3 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)
B5Y306 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Klebsiella pneumoniae (strain 342)
B7LLY4 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73)
B2VCV9 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99)
A4W5T1 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Enterobacter sp. (strain 638)
C5BF78 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Edwardsiella ictaluri (strain 93-146)
Q1R358 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Escherichia coli (strain UTI89 / UPEC)
B1LQM1 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Escherichia coli (strain SMS-3-5 / SECEC)
B6I2A8 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Escherichia coli (strain SE11)
B7NGD6 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)
P0A7T7 4.69e-49 151 98 0 75 1 rpsR Small ribosomal subunit protein bS18 Escherichia coli (strain K12)
B1IT04 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks)
P0A7T8 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Q0T9J1 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Escherichia coli O6:K15:H31 (strain 536 / UPEC)
A8A7U8 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Escherichia coli O9:H4 (strain HS)
B1XDV2 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Escherichia coli (strain K12 / DH10B)
C4ZR79 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Escherichia coli (strain K12 / MC4100 / BW2952)
B7M9G4 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Escherichia coli O8 (strain IAI1)
B7MST2 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Escherichia coli O81 (strain ED1a)
B7NTQ7 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Escherichia coli O7:K1 (strain IAI39 / ExPEC)
B5Z2K7 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Escherichia coli O157:H7 (strain EC4115 / EHEC)
P0A7T9 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Escherichia coli O157:H7
B7LCR3 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Escherichia coli (strain 55989 / EAEC)
B7MLK7 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Escherichia coli O45:K1 (strain S88 / ExPEC)
B7UQL1 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Escherichia coli O127:H6 (strain E2348/69 / EPEC)
A7ZV73 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Escherichia coli O139:H28 (strain E24377A / ETEC)
A7MM78 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Cronobacter sakazakii (strain ATCC BAA-894)
A8AMJ6 4.69e-49 151 98 0 75 3 rpsR Small ribosomal subunit protein bS18 Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)
A1SA58 3.69e-48 149 97 0 75 3 rpsR Small ribosomal subunit protein bS18 Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
Q8ZK81 4.45e-48 149 97 0 75 1 rpsR Small ribosomal subunit protein bS18 Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
C6DE13 5.31e-48 149 97 0 75 3 rpsR Small ribosomal subunit protein bS18 Pectobacterium carotovorum subsp. carotovorum (strain PC1)
Q6D137 5.31e-48 149 97 0 75 3 rpsR Small ribosomal subunit protein bS18 Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
A3QI50 1.2e-47 148 96 0 75 3 rpsR Small ribosomal subunit protein bS18 Shewanella loihica (strain ATCC BAA-1088 / PV-4)
A1RNI7 1.44e-47 148 96 0 75 3 rpsR Small ribosomal subunit protein bS18 Shewanella sp. (strain W3-18-1)
Q0HYW4 1.44e-47 148 96 0 75 3 rpsR Small ribosomal subunit protein bS18 Shewanella sp. (strain MR-7)
Q0HF41 1.44e-47 148 96 0 75 3 rpsR Small ribosomal subunit protein bS18 Shewanella sp. (strain MR-4)
A0KT22 1.44e-47 148 96 0 75 3 rpsR Small ribosomal subunit protein bS18 Shewanella sp. (strain ANA-3)
A4Y3F2 1.44e-47 148 96 0 75 3 rpsR Small ribosomal subunit protein bS18 Shewanella putrefaciens (strain CN-32 / ATCC BAA-453)
Q8EAH4 1.44e-47 148 96 0 75 3 rpsR Small ribosomal subunit protein bS18 Shewanella oneidensis (strain ATCC 700550 / JCM 31522 / CIP 106686 / LMG 19005 / NCIMB 14063 / MR-1)
A9L122 1.44e-47 148 96 0 75 3 rpsR Small ribosomal subunit protein bS18 Shewanella baltica (strain OS195)
A6WJ81 1.44e-47 148 96 0 75 3 rpsR Small ribosomal subunit protein bS18 Shewanella baltica (strain OS185)
A3D8Q3 1.44e-47 148 96 0 75 3 rpsR Small ribosomal subunit protein bS18 Shewanella baltica (strain OS155 / ATCC BAA-1091)
B8E9N8 1.44e-47 148 96 0 75 3 rpsR Small ribosomal subunit protein bS18 Shewanella baltica (strain OS223)
Q2NW53 2.53e-47 147 96 0 75 3 rpsR Small ribosomal subunit protein bS18 Sodalis glossinidius (strain morsitans)
B1JMM2 3.08e-47 147 96 0 75 3 rpsR Small ribosomal subunit protein bS18 Yersinia pseudotuberculosis serotype O:3 (strain YPIII)
Q66FA0 3.08e-47 147 96 0 75 3 rpsR Small ribosomal subunit protein bS18 Yersinia pseudotuberculosis serotype I (strain IP32953)
A4TRM4 3.08e-47 147 96 0 75 3 rpsR Small ribosomal subunit protein bS18 Yersinia pestis (strain Pestoides F)
Q1CEH2 3.08e-47 147 96 0 75 3 rpsR Small ribosomal subunit protein bS18 Yersinia pestis bv. Antiqua (strain Nepal516)
A9QYL4 3.08e-47 147 96 0 75 3 rpsR Small ribosomal subunit protein bS18 Yersinia pestis bv. Antiqua (strain Angola)
Q8ZB83 3.08e-47 147 96 0 75 3 rpsR Small ribosomal subunit protein bS18 Yersinia pestis
B2K2L5 3.08e-47 147 96 0 75 3 rpsR Small ribosomal subunit protein bS18 Yersinia pseudotuberculosis serotype IB (strain PB1/+)
Q1CBW6 3.08e-47 147 96 0 75 3 rpsR Small ribosomal subunit protein bS18 Yersinia pestis bv. Antiqua (strain Antiqua)
A7FMW3 3.08e-47 147 96 0 75 3 rpsR Small ribosomal subunit protein bS18 Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)
A1JIT0 3.08e-47 147 96 0 75 3 rpsR Small ribosomal subunit protein bS18 Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
A8G8W6 3.08e-47 147 96 0 75 3 rpsR Small ribosomal subunit protein bS18 Serratia proteamaculans (strain 568)
Q12RW7 4.05e-47 147 94 0 75 3 rpsR Small ribosomal subunit protein bS18 Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013)
B1KHY8 4.33e-47 147 94 0 75 3 rpsR Small ribosomal subunit protein bS18 Shewanella woodyi (strain ATCC 51908 / MS32)
A8FR97 4.33e-47 147 94 0 75 3 rpsR Small ribosomal subunit protein bS18 Shewanella sediminis (strain HAW-EB3)
B8CIQ3 4.33e-47 147 94 0 75 3 rpsR Small ribosomal subunit protein bS18 Shewanella piezotolerans (strain WP3 / JCM 13877)
A8H8L0 4.33e-47 147 94 0 75 3 rpsR Small ribosomal subunit protein bS18 Shewanella pealeana (strain ATCC 700345 / ANG-SQ1)
B0TUU7 4.33e-47 147 94 0 75 3 rpsR Small ribosomal subunit protein bS18 Shewanella halifaxensis (strain HAW-EB4)
Q07XS9 1.71e-46 145 93 0 75 3 rpsR Small ribosomal subunit protein bS18 Shewanella frigidimarina (strain NCIMB 400)
B8D884 4.29e-46 144 92 0 75 3 rpsR Small ribosomal subunit protein bS18 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7)
P57626 4.29e-46 144 92 0 75 3 rpsR Small ribosomal subunit protein bS18 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS)
B8D8C7 4.29e-46 144 92 0 75 3 rpsR Small ribosomal subunit protein bS18 Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A)
A1T040 4.69e-46 144 92 0 75 3 rpsR Small ribosomal subunit protein bS18 Psychromonas ingrahamii (strain DSM 17664 / CCUG 51855 / 37)
Q65VD2 5.47e-46 144 93 0 75 3 rpsR Small ribosomal subunit protein bS18 Mannheimia succiniciproducens (strain KCTC 0769BP / MBEL55E)
B0US45 5.47e-46 144 93 0 75 3 rpsR Small ribosomal subunit protein bS18 Histophilus somni (strain 2336)
Q0I4E7 5.47e-46 144 93 0 75 3 rpsR Small ribosomal subunit protein bS18 Histophilus somni (strain 129Pt)
A6VMD4 5.47e-46 144 93 0 75 3 rpsR Small ribosomal subunit protein bS18 Actinobacillus succinogenes (strain ATCC 55618 / DSM 22257 / CCUG 43843 / 130Z)
P57916 8.12e-46 143 92 0 75 3 rpsR Small ribosomal subunit protein bS18 Pasteurella multocida (strain Pm70)
Q1LSR4 1.02e-45 143 94 0 75 3 rpsR Small ribosomal subunit protein bS18 Baumannia cicadellinicola subsp. Homalodisca coagulata
P66457 1.66e-45 142 92 0 75 3 rpsR Small ribosomal subunit protein bS18 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
A5UH50 1.66e-45 142 92 0 75 3 rpsR Small ribosomal subunit protein bS18 Haemophilus influenzae (strain PittGG)
A5U9V0 1.66e-45 142 92 0 75 3 rpsR Small ribosomal subunit protein bS18 Haemophilus influenzae (strain PittEE)
Q4QN03 1.66e-45 142 92 0 75 3 rpsR Small ribosomal subunit protein bS18 Haemophilus influenzae (strain 86-028NP)
P66458 1.66e-45 142 92 0 75 3 rpsR Small ribosomal subunit protein bS18 Haemophilus ducreyi (strain 35000HP / ATCC 700724)
B8F5T5 1.66e-45 142 92 0 75 3 rpsR Small ribosomal subunit protein bS18 Glaesserella parasuis serovar 5 (strain SH0165)
B0BQB1 1.66e-45 142 92 0 75 3 rpsR Small ribosomal subunit protein bS18 Actinobacillus pleuropneumoniae serotype 3 (strain JL03)
B3GY57 1.66e-45 142 92 0 75 3 rpsR Small ribosomal subunit protein bS18 Actinobacillus pleuropneumoniae serotype 7 (strain AP76)
A0KG68 1.59e-44 140 90 0 75 3 rpsR Small ribosomal subunit protein bS18 Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049)
Q8K919 1.59e-44 140 86 0 75 3 rpsR Small ribosomal subunit protein bS18 Buchnera aphidicola subsp. Schizaphis graminum (strain Sg)
Q3II81 1.61e-44 140 88 0 75 3 rpsR Small ribosomal subunit protein bS18 Pseudoalteromonas translucida (strain TAC 125)
A4SIZ8 2.33e-44 140 89 0 75 3 rpsR Small ribosomal subunit protein bS18 Aeromonas salmonicida (strain A449)
P59502 3.36e-44 139 86 0 75 3 rpsR Small ribosomal subunit protein bS18 Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)
Q0AB49 3.94e-44 139 86 0 74 3 rpsR Small ribosomal subunit protein bS18 Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1)
A1WUS6 3e-43 137 85 0 74 3 rpsR Small ribosomal subunit protein bS18 Halorhodospira halophila (strain DSM 244 / SL1)
C4K432 6.48e-43 136 87 0 74 3 rpsR Small ribosomal subunit protein bS18 Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT)
B8GNS3 1.19e-40 130 81 0 74 3 rpsR Small ribosomal subunit protein bS18 Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)
Q31FW5 1.8e-40 130 81 0 75 3 rpsR Small ribosomal subunit protein bS18 Hydrogenovibrio crunogenus (strain DSM 25203 / XCL-2)
Q056X9 3.26e-40 129 78 0 75 3 rpsR Small ribosomal subunit protein bS18 Buchnera aphidicola subsp. Cinara cedri (strain Cc)
Q1QBZ1 1.01e-39 128 78 0 75 3 rpsR Small ribosomal subunit protein bS18 Psychrobacter cryohalolentis (strain ATCC BAA-1226 / DSM 17306 / VKM B-2378 / K5)
Q4FS20 1.01e-39 128 78 0 75 3 rpsR Small ribosomal subunit protein bS18 Psychrobacter arcticus (strain DSM 17307 / VKM B-2377 / 273-4)
A5WFZ0 3.65e-39 127 77 0 75 3 rpsR Small ribosomal subunit protein bS18 Psychrobacter sp. (strain PRwf-1)
Q3BV20 5.34e-39 126 72 0 74 3 rpsR Small ribosomal subunit protein bS18 Xanthomonas euvesicatoria pv. vesicatoria (strain 85-10)
Q8PM13 5.34e-39 126 72 0 74 3 rpsR Small ribosomal subunit protein bS18 Xanthomonas axonopodis pv. citri (strain 306)
B2FKJ8 5.34e-39 126 72 0 74 3 rpsR Small ribosomal subunit protein bS18 Stenotrophomonas maltophilia (strain K279a)
B4SP93 6.02e-39 126 72 0 74 3 rpsR Small ribosomal subunit protein bS18 Stenotrophomonas maltophilia (strain R551-3)
Q8D2U3 7.88e-39 125 78 0 75 3 rpsR Small ribosomal subunit protein bS18 Wigglesworthia glossinidia brevipalpis
B0V7G6 1e-38 125 80 0 75 3 rpsR Small ribosomal subunit protein bS18 Acinetobacter baumannii (strain AYE)
A3M6Q5 1e-38 125 80 0 75 3 rpsR Small ribosomal subunit protein bS18 Acinetobacter baumannii (strain ATCC 17978 / DSM 105126 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)
B0VM09 1e-38 125 80 0 75 3 rpsR Small ribosomal subunit protein bS18 Acinetobacter baumannii (strain SDF)
B2HUA3 1e-38 125 80 0 75 3 rpsR Small ribosomal subunit protein bS18 Acinetobacter baumannii (strain ACICU)
B7IBC2 1e-38 125 80 0 75 1 rpsR Small ribosomal subunit protein bS18 Acinetobacter baumannii (strain AB0057)
B7H0J9 1e-38 125 80 0 75 3 rpsR Small ribosomal subunit protein bS18 Acinetobacter baumannii (strain AB307-0294)
Q5H052 1.5e-38 125 71 0 74 3 rpsR Small ribosomal subunit protein bS18 Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)
B2SIV1 1.5e-38 125 71 0 74 3 rpsR Small ribosomal subunit protein bS18 Xanthomonas oryzae pv. oryzae (strain PXO99A)
Q2P329 1.5e-38 125 71 0 74 3 rpsR Small ribosomal subunit protein bS18 Xanthomonas oryzae pv. oryzae (strain MAFF 311018)
Q8PAC1 1.5e-38 125 71 0 74 3 rpsR Small ribosomal subunit protein bS18 Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)
B0RUY8 1.5e-38 125 71 0 74 3 rpsR Small ribosomal subunit protein bS18 Xanthomonas campestris pv. campestris (strain B100)
Q4UTA4 1.5e-38 125 71 0 74 3 rpsR Small ribosomal subunit protein bS18 Xanthomonas campestris pv. campestris (strain 8004)
Q0VMG1 1.89e-38 125 77 0 75 3 rpsR Small ribosomal subunit protein bS18 Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)
Q6F9Q9 2.75e-38 124 78 0 75 3 rpsR Small ribosomal subunit protein bS18 Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
Q9PAF8 5.36e-38 124 70 0 74 3 rpsR Small ribosomal subunit protein bS18 Xylella fastidiosa (strain 9a5c)
C3LRA0 9.52e-38 123 93 0 75 3 rpsR Small ribosomal subunit protein bS18 Vibrio cholerae serotype O1 (strain M66-2)
Q9KUZ0 9.52e-38 123 93 0 75 3 rpsR Small ribosomal subunit protein bS18 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
A5F3K5 9.52e-38 123 93 0 75 3 rpsR Small ribosomal subunit protein bS18 Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)
Q7MH90 2.64e-37 122 92 0 75 3 rpsR Small ribosomal subunit protein bS18 Vibrio vulnificus (strain YJ016)
P66479 2.64e-37 122 92 0 75 3 rpsR Small ribosomal subunit protein bS18 Vibrio vulnificus (strain CMCP6)
P66478 2.64e-37 122 92 0 75 3 rpsR Small ribosomal subunit protein bS18 Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)
A7MSX6 2.64e-37 122 92 0 75 3 rpsR Small ribosomal subunit protein bS18 Vibrio campbellii (strain ATCC BAA-1116)
B7VI66 2.64e-37 122 92 0 75 3 rpsR Small ribosomal subunit protein bS18 Vibrio atlanticus (strain LGP32)
Q493V4 6.53e-37 121 76 0 75 3 rpsR Small ribosomal subunit protein bS18 Blochmanniella pennsylvanica (strain BPEN)
Q606H9 1.68e-36 120 72 0 75 3 rpsR Small ribosomal subunit protein bS18 Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)
Q87A84 1.96e-36 120 67 0 74 3 rpsR Small ribosomal subunit protein bS18 Xylella fastidiosa (strain Temecula1 / ATCC 700964)
B0U5H1 1.96e-36 120 67 0 74 3 rpsR Small ribosomal subunit protein bS18 Xylella fastidiosa (strain M12)
B2I9S8 1.96e-36 120 67 0 74 3 rpsR Small ribosomal subunit protein bS18 Xylella fastidiosa (strain M23)
Q5QY03 5.78e-36 119 92 0 75 3 rpsR Small ribosomal subunit protein bS18 Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)
A4IY06 6.48e-36 118 80 0 68 3 rpsR Small ribosomal subunit protein bS18 Francisella tularensis subsp. tularensis (strain WY96-3418)
Q5NG00 6.48e-36 118 80 0 68 3 rpsR Small ribosomal subunit protein bS18 Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
A0Q6H3 6.48e-36 118 80 0 68 3 rpsR Small ribosomal subunit protein bS18 Francisella tularensis subsp. novicida (strain U112)
Q14HF2 6.48e-36 118 80 0 68 3 rpsR Small ribosomal subunit protein bS18 Francisella tularensis subsp. tularensis (strain FSC 198)
Q5WWL9 1.71e-35 117 71 0 74 3 rpsR Small ribosomal subunit protein bS18 Legionella pneumophila (strain Lens)
Q5ZV49 1.71e-35 117 71 0 74 3 rpsR Small ribosomal subunit protein bS18 Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)
A5IC89 1.71e-35 117 71 0 74 3 rpsR Small ribosomal subunit protein bS18 Legionella pneumophila (strain Corby)
Q5X4X1 1.71e-35 117 71 0 74 3 rpsR Small ribosomal subunit protein bS18 Legionella pneumophila (strain Paris)
B6EMP4 2.09e-35 117 90 0 74 3 rpsR Small ribosomal subunit protein bS18 Aliivibrio salmonicida (strain LFI1238)
B5FBQ1 2.09e-35 117 90 0 74 3 rpsR Small ribosomal subunit protein bS18 Aliivibrio fischeri (strain MJ11)
Q5E2E0 2.09e-35 117 90 0 74 3 rpsR Small ribosomal subunit protein bS18 Aliivibrio fischeri (strain ATCC 700601 / ES114)
B0U080 2.29e-35 117 79 0 68 3 rpsR Small ribosomal subunit protein bS18 Francisella philomiragia subsp. philomiragia (strain ATCC 25017 / CCUG 19701 / FSC 153 / O#319-036)
Q0BLY9 2.7e-35 117 79 0 68 3 rpsR Small ribosomal subunit protein bS18 Francisella tularensis subsp. holarctica (strain OSU18)
Q2A3H6 5.05e-35 116 79 0 68 3 rpsR Small ribosomal subunit protein bS18 Francisella tularensis subsp. holarctica (strain LVS)
A7NC55 5.05e-35 116 79 0 68 3 rpsR Small ribosomal subunit protein bS18 Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA)
B4S011 7.22e-35 115 89 0 75 3 rpsR Small ribosomal subunit protein bS18 Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype)
C1DCR2 3.21e-34 114 68 1 75 3 rpsR Small ribosomal subunit protein bS18 Laribacter hongkongensis (strain HLHK9)
Q83D75 3.32e-34 114 71 0 71 3 rpsR Small ribosomal subunit protein bS18 Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
A9ND52 3.32e-34 114 71 0 71 3 rpsR Small ribosomal subunit protein bS18 Coxiella burnetii (strain RSA 331 / Henzerling II)
A9KFL6 3.32e-34 114 71 0 71 3 rpsR Small ribosomal subunit protein bS18 Coxiella burnetii (strain Dugway 5J108-111)
A5EXN0 4.18e-34 114 75 0 69 3 rpsR Small ribosomal subunit protein bS18 Dichelobacter nodosus (strain VCS1703A)
A1KUE8 5.01e-34 114 68 1 76 3 rpsR Small ribosomal subunit protein bS18 Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18)
P0A0X7 5.01e-34 114 68 1 76 3 rpsR Small ribosomal subunit protein bS18 Neisseria meningitidis serogroup B (strain ATCC BAA-335 / MC58)
P0A0X6 5.01e-34 114 68 1 76 3 rpsR Small ribosomal subunit protein bS18 Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491)
A9LZQ1 5.01e-34 114 68 1 76 3 rpsR Small ribosomal subunit protein bS18 Neisseria meningitidis serogroup C (strain 053442)
P0A0X8 5.01e-34 114 68 1 76 3 rpsR Small ribosomal subunit protein bS18 Neisseria gonorrhoeae
B4RMH8 5.01e-34 114 68 1 76 3 rpsR Small ribosomal subunit protein bS18 Neisseria gonorrhoeae (strain NCCP11945)
Q5F923 5.01e-34 114 68 1 76 3 rpsR Small ribosomal subunit protein bS18 Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Q1H1P1 6.21e-34 113 65 1 75 3 rpsR Small ribosomal subunit protein bS18 Methylobacillus flagellatus (strain ATCC 51484 / DSM 6875 / VKM B-1610 / KT)
Q7NRY9 1.11e-33 113 68 1 75 3 rpsR Small ribosomal subunit protein bS18 Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / CCUG 213 / NBRC 12614 / NCIMB 9131 / NCTC 9757 / MK)
A9IT96 1.13e-33 113 69 0 71 3 rpsR Small ribosomal subunit protein bS18 Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448)
Q489T9 1.15e-33 113 89 0 65 3 rpsR Small ribosomal subunit protein bS18 Colwellia psychrerythraea (strain 34H / ATCC BAA-681)
Q6LM43 1.23e-33 112 87 0 74 3 rpsR Small ribosomal subunit protein bS18 Photobacterium profundum (strain SS9)
Q2KZ21 3.11e-33 112 69 0 71 3 rpsR Small ribosomal subunit protein bS18 Bordetella avium (strain 197N)
Q7VV91 3.32e-33 112 69 0 71 3 rpsR Small ribosomal subunit protein bS18 Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)
Q7W7P6 3.32e-33 112 69 0 71 3 rpsR Small ribosomal subunit protein bS18 Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253)
Q7WL33 3.32e-33 112 69 0 71 3 rpsR Small ribosomal subunit protein bS18 Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)
Q3JEJ5 4.26e-33 111 86 0 74 3 rpsR Small ribosomal subunit protein bS18 Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / JCM 30415 / NCIMB 11848 / C-107)
Q2Y7M7 4.35e-33 112 67 0 70 3 rpsR Small ribosomal subunit protein bS18 Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849 / C 71)
B2JG20 4.4e-33 112 69 0 71 3 rpsR Small ribosomal subunit protein bS18 Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815)
Q2SWJ7 8.78e-33 111 69 0 71 3 rpsR Small ribosomal subunit protein bS18 Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CCUG 48851 / CIP 106301 / E264)
Q63UY4 8.78e-33 111 69 0 71 3 rpsR Small ribosomal subunit protein bS18 Burkholderia pseudomallei (strain K96243)
A3NAB4 8.78e-33 111 69 0 71 3 rpsR Small ribosomal subunit protein bS18 Burkholderia pseudomallei (strain 668)
Q3JRJ4 8.78e-33 111 69 0 71 3 rpsR Small ribosomal subunit protein bS18 Burkholderia pseudomallei (strain 1710b)
A3NW32 8.78e-33 111 69 0 71 3 rpsR Small ribosomal subunit protein bS18 Burkholderia pseudomallei (strain 1106a)
Q1BH34 8.78e-33 111 69 0 71 3 rpsR Small ribosomal subunit protein bS18 Burkholderia orbicola (strain AU 1054)
A1V4Q9 8.78e-33 111 69 0 71 3 rpsR Small ribosomal subunit protein bS18 Burkholderia mallei (strain SAVP1)
Q62JR1 8.78e-33 111 69 0 71 3 rpsR Small ribosomal subunit protein bS18 Burkholderia mallei (strain ATCC 23344)
A2S244 8.78e-33 111 69 0 71 3 rpsR Small ribosomal subunit protein bS18 Burkholderia mallei (strain NCTC 10229)
A3MKD4 8.78e-33 111 69 0 71 3 rpsR Small ribosomal subunit protein bS18 Burkholderia mallei (strain NCTC 10247)
A9AJW3 8.78e-33 111 69 0 71 3 rpsR Small ribosomal subunit protein bS18 Burkholderia multivorans (strain ATCC 17616 / 249)
A0K7Z6 8.78e-33 111 69 0 71 3 rpsR Small ribosomal subunit protein bS18 Burkholderia cenocepacia (strain HI2424)
B1JTF1 1.06e-32 111 69 0 71 3 rpsR Small ribosomal subunit protein bS18 Burkholderia orbicola (strain MC0-3)
Q39FK0 1.06e-32 111 69 0 71 3 rpsR Small ribosomal subunit protein bS18 Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)
B4EBH1 1.06e-32 111 69 0 71 3 rpsR Small ribosomal subunit protein bS18 Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)
A4JEU9 1.91e-32 110 69 0 71 3 rpsR Small ribosomal subunit protein bS18 Burkholderia vietnamiensis (strain G4 / LMG 22486)
Q0BEQ8 2.21e-32 110 69 0 71 3 rpsR Small ribosomal subunit protein bS18 Burkholderia ambifaria (strain ATCC BAA-244 / DSM 16087 / CCUG 44356 / LMG 19182 / AMMD)
B1YRJ2 2.21e-32 110 69 0 71 3 rpsR Small ribosomal subunit protein bS18 Burkholderia ambifaria (strain MC40-6)
Q82XQ8 2.75e-32 109 67 0 70 3 rpsR Small ribosomal subunit protein bS18 Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298)
Q3SH33 4.4e-32 109 68 0 70 3 rpsR Small ribosomal subunit protein bS18 Thiobacillus denitrificans (strain ATCC 25259)
Q15PE1 5.9e-32 108 82 0 75 3 rpsR Small ribosomal subunit protein bS18 Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087)
A1WAR2 6.63e-32 108 64 0 71 3 rpsR Small ribosomal subunit protein bS18 Acidovorax sp. (strain JS42)
B9MDJ3 6.63e-32 108 64 0 71 3 rpsR Small ribosomal subunit protein bS18 Acidovorax ebreus (strain TPSY)
Q0ADI8 6.85e-32 108 65 0 70 3 rpsR Small ribosomal subunit protein bS18 Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57)
C4LAB7 8.62e-32 108 87 0 65 3 rpsR Small ribosomal subunit protein bS18 Tolumonas auensis (strain DSM 9187 / NBRC 110442 / TA 4)
Q2SLB4 8.62e-32 108 84 0 75 3 rpsR Small ribosomal subunit protein bS18 Hahella chejuensis (strain KCTC 2396)
Q8XZT6 1.18e-31 108 64 0 71 3 rpsR Small ribosomal subunit protein bS18 Ralstonia nicotianae (strain ATCC BAA-1114 / GMI1000)
Q13ZH0 1.38e-31 108 66 0 71 3 rpsR Small ribosomal subunit protein bS18 Paraburkholderia xenovorans (strain LB400)
A9BNG1 1.94e-31 107 64 0 71 3 rpsR Small ribosomal subunit protein bS18 Delftia acidovorans (strain DSM 14801 / SPH-1)
C5CUP2 2.12e-31 107 63 0 71 3 rpsR Small ribosomal subunit protein bS18 Variovorax paradoxus (strain S110)
A1TLI3 2.12e-31 107 63 0 71 3 rpsR Small ribosomal subunit protein bS18 Paracidovorax citrulli (strain AAC00-1)
Q21WD4 2.87e-31 107 63 0 71 3 rpsR Small ribosomal subunit protein bS18 Albidiferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)
A1VPX2 2.9e-31 107 60 0 71 3 rpsR Small ribosomal subunit protein bS18 Polaromonas naphthalenivorans (strain CJ2)
A1U392 3.29e-31 107 84 0 75 3 rpsR Small ribosomal subunit protein bS18 Marinobacter nauticus (strain ATCC 700491 / DSM 11845 / VT8)
Q9HUN0 3.75e-31 106 83 0 74 1 rpsR Small ribosomal subunit protein bS18 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
Q02F84 3.75e-31 106 83 0 74 3 rpsR Small ribosomal subunit protein bS18 Pseudomonas aeruginosa (strain UCBPP-PA14)
B7V1Z7 3.75e-31 106 83 0 74 3 rpsR Small ribosomal subunit protein bS18 Pseudomonas aeruginosa (strain LESB58)
A6VD47 3.75e-31 106 83 0 74 3 rpsR Small ribosomal subunit protein bS18 Pseudomonas aeruginosa (strain PA7)
B3R2P5 3.76e-31 107 64 0 71 3 rpsR Small ribosomal subunit protein bS18 Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CCUG 44338 / CIP 107171 / LMG 19424 / R1)
A1WGK3 4.98e-31 107 61 0 71 3 rpsR Small ribosomal subunit protein bS18 Verminephrobacter eiseniae (strain EF01-2)
Q128U3 5.6e-31 106 60 0 71 3 rpsR Small ribosomal subunit protein bS18 Polaromonas sp. (strain JS666 / ATCC BAA-500)
Q1QZ62 6.25e-31 106 84 0 75 3 rpsR Small ribosomal subunit protein bS18 Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11)
Q0K9E7 7.35e-31 106 63 0 71 3 rpsR Small ribosomal subunit protein bS18 Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337)
Q1LLX0 7.35e-31 106 63 0 71 3 rpsR Small ribosomal subunit protein bS18 Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
A4SVX8 7.57e-31 106 63 0 71 3 rpsR Small ribosomal subunit protein bS18 Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)
Q46ZR5 7.67e-31 106 63 0 71 3 rpsR1 Small ribosomal subunit protein bS18A Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A4VQM9 1.1e-30 105 83 0 74 3 rpsR Small ribosomal subunit protein bS18 Stutzerimonas stutzeri (strain A1501)
C5BN46 1.16e-30 105 80 0 65 3 rpsR Small ribosomal subunit protein bS18 Teredinibacter turnerae (strain ATCC 39867 / T7901)
B2T3N5 1.18e-30 105 64 0 71 3 rpsR Small ribosomal subunit protein bS18 Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)
B1XTM7 1.32e-30 105 63 0 71 3 rpsR Small ribosomal subunit protein bS18 Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Q46P61 1.62e-30 105 63 0 71 3 rpsR2 Small ribosomal subunit protein bS18B Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197)
A6W0Y8 1.88e-30 105 82 0 74 3 rpsR Small ribosomal subunit protein bS18 Marinomonas sp. (strain MWYL1)
B3PCS1 2.04e-30 104 82 0 75 3 rpsR Small ribosomal subunit protein bS18 Cellvibrio japonicus (strain Ueda107)
A2SG01 2.87e-30 105 63 0 71 3 rpsR Small ribosomal subunit protein bS18 Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)
C1DLR3 3.44e-30 104 82 0 74 3 rpsR Small ribosomal subunit protein bS18 Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
A1AWV0 7.21e-30 103 69 0 66 3 rpsR Small ribosomal subunit protein bS18 Ruthia magnifica subsp. Calyptogena magnifica
Q21LV9 9.4e-30 103 78 0 75 3 rpsR Small ribosomal subunit protein bS18 Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024)
B1XXH3 1.68e-29 103 60 0 71 3 rpsR Small ribosomal subunit protein bS18 Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6)
A5CWE0 7.14e-29 101 59 1 83 3 rpsR Small ribosomal subunit protein bS18 Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA)
A4XPZ8 1.53e-28 100 79 0 74 3 rpsR Small ribosomal subunit protein bS18 Pseudomonas mendocina (strain ymp)
Q7VQN8 1.57e-28 100 61 0 75 3 rpsR Small ribosomal subunit protein bS18 Blochmanniella floridana
B1JAH0 2.33e-28 99 78 0 74 3 rpsR Small ribosomal subunit protein bS18 Pseudomonas putida (strain W619)
Q88DE9 2.33e-28 99 78 0 74 3 rpsR Small ribosomal subunit protein bS18 Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440)
B0KKY2 2.33e-28 99 78 0 74 3 rpsR Small ribosomal subunit protein bS18 Pseudomonas putida (strain GB-1)
A5W9R7 2.33e-28 99 78 0 74 3 rpsR Small ribosomal subunit protein bS18 Pseudomonas putida (strain ATCC 700007 / DSM 6899 / JCM 31910 / BCRC 17059 / LMG 24140 / F1)
Q1I462 2.33e-28 99 78 0 74 3 rpsR Small ribosomal subunit protein bS18 Pseudomonas entomophila (strain L48)
Q4ZYX0 1.33e-27 97 78 0 74 3 rpsR Small ribosomal subunit protein bS18 Pseudomonas syringae pv. syringae (strain B728a)
Q87VK4 1.33e-27 97 78 0 74 3 rpsR Small ribosomal subunit protein bS18 Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)
Q3KIX7 1.33e-27 97 78 0 74 3 rpsR Small ribosomal subunit protein bS18 Pseudomonas fluorescens (strain Pf0-1)
C3KE68 1.33e-27 97 78 0 74 3 rpsR Small ribosomal subunit protein bS18 Pseudomonas fluorescens (strain SBW25)
Q4KJ61 1.33e-27 97 78 0 74 3 rpsR Small ribosomal subunit protein bS18 Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)
Q48NZ2 1.33e-27 97 78 0 74 3 rpsR Small ribosomal subunit protein bS18 Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
Q2W5H0 1.09e-26 95 66 0 68 3 rpsR Small ribosomal subunit protein bS18 Paramagnetospirillum magneticum (strain ATCC 700264 / AMB-1)
Q1GHT9 1.31e-26 95 66 0 68 3 rpsR Small ribosomal subunit protein bS18 Ruegeria sp. (strain TM1040)
Q5LR49 2.86e-26 94 64 0 68 3 rpsR Small ribosomal subunit protein bS18 Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)
A8LQQ6 4.34e-26 94 64 0 68 3 rpsR Small ribosomal subunit protein bS18 Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
Q164N6 4.68e-26 94 64 0 68 3 rpsR Small ribosomal subunit protein bS18 Roseobacter denitrificans (strain ATCC 33942 / OCh 114)
A1B0F7 7.58e-26 93 64 0 68 3 rpsR Small ribosomal subunit protein bS18 Paracoccus denitrificans (strain Pd 1222)
B8GVN5 1.34e-25 93 61 0 68 3 rpsR Small ribosomal subunit protein bS18 Caulobacter vibrioides (strain NA1000 / CB15N)
Q9A7Q2 1.34e-25 93 61 0 68 3 rpsR Small ribosomal subunit protein bS18 Caulobacter vibrioides (strain ATCC 19089 / CIP 103742 / CB 15)
B0SWL0 1.34e-25 93 61 0 68 3 rpsR Small ribosomal subunit protein bS18 Caulobacter sp. (strain K31)
O68127 1.34e-25 92 61 0 68 3 rbsR Small ribosomal subunit protein bS18 Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)
Q07LE1 2.37e-25 92 64 0 70 3 rpsR Small ribosomal subunit protein bS18 Rhodopseudomonas palustris (strain BisA53)
Q2IX92 2.37e-25 92 64 0 70 3 rpsR Small ribosomal subunit protein bS18 Rhodopseudomonas palustris (strain HaA2)
Q89MW4 2.83e-25 92 64 0 70 3 rpsR Small ribosomal subunit protein bS18 Bradyrhizobium diazoefficiens (strain JCM 10833 / BCRC 13528 / IAM 13628 / NBRC 14792 / USDA 110)
B3Q9T6 3.29e-25 91 64 0 70 3 rpsR Small ribosomal subunit protein bS18 Rhodopseudomonas palustris (strain TIE-1)
Q6N5A3 3.29e-25 91 64 0 70 1 rpsR Small ribosomal subunit protein bS18 Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)
Q5NN60 3.43e-25 91 61 1 71 3 rpsR Small ribosomal subunit protein bS18 Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)
C5D9X4 3.66e-25 91 63 0 66 3 rpsR Small ribosomal subunit protein bS18 Geobacillus sp. (strain WCH70)
Q1QKU9 3.68e-25 91 64 0 70 3 rpsR Small ribosomal subunit protein bS18 Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)
Q135M7 3.88e-25 91 64 0 70 3 rpsR Small ribosomal subunit protein bS18 Rhodopseudomonas palustris (strain BisB5)
Q3SRY8 5.46e-25 91 62 0 70 3 rpsR Small ribosomal subunit protein bS18 Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)
Q215T7 7.02e-25 90 62 0 70 3 rpsR Small ribosomal subunit protein bS18 Rhodopseudomonas palustris (strain BisB18)
A5V2E1 7.07e-25 90 61 1 71 3 rpsR Small ribosomal subunit protein bS18 Rhizorhabdus wittichii (strain DSM 6014 / CCUG 31198 / JCM 15750 / NBRC 105917 / EY 4224 / RW1)
A4WS84 7.18e-25 90 63 0 68 3 rpsR Small ribosomal subunit protein bS18 Cereibacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)
Q3J1M0 7.18e-25 90 63 0 68 3 rpsR Small ribosomal subunit protein bS18 Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.)
A3PKL6 7.18e-25 90 63 0 68 3 rpsR Small ribosomal subunit protein bS18 Cereibacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)
A7GVN5 8.28e-25 90 62 0 66 3 rpsR Small ribosomal subunit protein bS18 Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98)
Q2N9S6 1.22e-24 90 61 1 71 3 rpsR Small ribosomal subunit protein bS18 Erythrobacter litoralis (strain HTCC2594)
B9KJP1 1.33e-24 90 63 0 68 3 rpsR Small ribosomal subunit protein bS18 Cereibacter sphaeroides (strain KD131 / KCTC 12085)
Q814G7 1.45e-24 90 62 0 66 3 rpsR Small ribosomal subunit protein bS18 Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711)
B9IT30 1.45e-24 90 62 0 66 3 rpsR Small ribosomal subunit protein bS18 Bacillus cereus (strain Q1)
B7HZF9 1.45e-24 90 62 0 66 3 rpsR Small ribosomal subunit protein bS18 Bacillus cereus (strain AH187)
B7HGD2 1.45e-24 90 62 0 66 3 rpsR Small ribosomal subunit protein bS18 Bacillus cereus (strain B4264)
B7IS16 1.45e-24 90 62 0 66 3 rpsR Small ribosomal subunit protein bS18 Bacillus cereus (strain G9842)
Q72WV5 1.45e-24 90 62 0 66 3 rpsR Small ribosomal subunit protein bS18 Bacillus cereus (strain ATCC 10987 / NRS 248)
Q8CQP6 1.83e-24 90 60 0 68 3 rpsR Small ribosomal subunit protein bS18 Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200)
Q5HRZ3 1.83e-24 90 60 0 68 3 rpsR Small ribosomal subunit protein bS18 Staphylococcus epidermidis (strain ATCC 35984 / DSM 28319 / BCRC 17069 / CCUG 31568 / BM 3577 / RP62A)
Q9K5P0 2.13e-24 89 59 2 77 3 rpsR Small ribosomal subunit protein bS18 Halalkalibacterium halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)
A5FYN7 2.2e-24 90 60 0 68 3 rpsR Small ribosomal subunit protein bS18 Acidiphilium cryptum (strain JF-5)
Q1GRV9 2.34e-24 89 61 1 71 3 rpsR Small ribosomal subunit protein bS18 Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)
A9VTK8 4.06e-24 89 60 0 66 3 rpsR Small ribosomal subunit protein bS18 Bacillus mycoides (strain KBAB4)
Q6HAG4 4.06e-24 89 60 0 66 3 rpsR Small ribosomal subunit protein bS18 Bacillus thuringiensis subsp. konkukian (strain 97-27)
Q630D0 4.06e-24 89 60 0 66 3 rpsR Small ribosomal subunit protein bS18 Bacillus cereus (strain ZK / E33L)
C1ER65 4.06e-24 89 60 0 66 3 rpsR Small ribosomal subunit protein bS18 Bacillus cereus (strain 03BB102)
B7JIJ9 4.06e-24 89 60 0 66 3 rpsR Small ribosomal subunit protein bS18 Bacillus cereus (strain AH820)
Q81JI4 4.06e-24 89 60 0 66 3 rpsR Small ribosomal subunit protein bS18 Bacillus anthracis
A0RLQ1 4.06e-24 89 60 0 66 3 rpsR Small ribosomal subunit protein bS18 Bacillus thuringiensis (strain Al Hakam)
C3LGS9 4.06e-24 89 60 0 66 3 rpsR Small ribosomal subunit protein bS18 Bacillus anthracis (strain CDC 684 / NRRL 3495)
C3P3E3 4.06e-24 89 60 0 66 3 rpsR Small ribosomal subunit protein bS18 Bacillus anthracis (strain A0248)
Q2G8G4 4.37e-24 89 59 1 71 3 rpsR Small ribosomal subunit protein bS18 Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199)
A8HVE8 4.52e-24 89 60 0 70 3 rpsR Small ribosomal subunit protein bS18 Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571)
P66469 5.08e-24 89 58 0 68 3 rpsR Small ribosomal subunit protein bS18 Staphylococcus aureus (strain MW2)
A8YZJ3 5.08e-24 89 58 0 68 3 rpsR Small ribosomal subunit protein bS18 Staphylococcus aureus (strain USA300 / TCH1516)
Q6GCA5 5.08e-24 89 58 0 68 3 rpsR Small ribosomal subunit protein bS18 Staphylococcus aureus (strain MSSA476)
Q6GJV1 5.08e-24 89 58 0 68 3 rpsR Small ribosomal subunit protein bS18 Staphylococcus aureus (strain MRSA252)
P66468 5.08e-24 89 58 0 68 1 rpsR Small ribosomal subunit protein bS18 Staphylococcus aureus (strain N315)
P66467 5.08e-24 89 58 0 68 3 rpsR Small ribosomal subunit protein bS18 Staphylococcus aureus (strain Mu50 / ATCC 700699)
A6QE49 5.08e-24 89 58 0 68 3 rpsR Small ribosomal subunit protein bS18 Staphylococcus aureus (strain Newman)
Q5HIS7 5.08e-24 89 58 0 68 3 rpsR Small ribosomal subunit protein bS18 Staphylococcus aureus (strain COL)
Q2YVJ0 5.08e-24 89 58 0 68 3 rpsR Small ribosomal subunit protein bS18 Staphylococcus aureus (strain bovine RF122 / ET3-1)
A5IPU8 5.08e-24 89 58 0 68 3 rpsR Small ribosomal subunit protein bS18 Staphylococcus aureus (strain JH9)
Q2G111 5.08e-24 89 58 0 68 1 rpsR Small ribosomal subunit protein bS18 Staphylococcus aureus (strain NCTC 8325 / PS 47)
Q2FJP6 5.08e-24 89 58 0 68 3 rpsR Small ribosomal subunit protein bS18 Staphylococcus aureus (strain USA300)
A6TYM0 5.08e-24 89 58 0 68 3 rpsR Small ribosomal subunit protein bS18 Staphylococcus aureus (strain JH1)
A7WY61 5.08e-24 89 58 0 68 3 rpsR Small ribosomal subunit protein bS18 Staphylococcus aureus (strain Mu3 / ATCC 700698)
Q11H15 5.67e-24 89 61 0 68 3 rpsR Small ribosomal subunit protein bS18 Chelativorans sp. (strain BNC1)
A1US55 5.98e-24 88 63 0 68 3 rpsR Small ribosomal subunit protein bS18 Bartonella bacilliformis (strain ATCC 35685 / KC583 / Herrer 020/F12,63)
Q49UQ2 6.12e-24 88 58 0 68 3 rpsR Small ribosomal subunit protein bS18 Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41)
Q5WAH5 7.02e-24 88 60 1 74 3 rpsR Small ribosomal subunit protein bS18 Shouchella clausii (strain KSM-K16)
B6JGW4 7.18e-24 88 61 0 70 3 rpsR Small ribosomal subunit protein bS18 Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5)
Q4L342 7.7e-24 88 63 0 63 3 rpsR Small ribosomal subunit protein bS18 Staphylococcus haemolyticus (strain JCSC1435)
A6WWE5 9.59e-24 88 61 0 68 3 rpsR Small ribosomal subunit protein bS18 Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37)
B9DIC0 9.91e-24 88 63 0 63 3 rpsR Small ribosomal subunit protein bS18 Staphylococcus carnosus (strain TM300)
Q0AQD3 1e-23 88 61 0 68 3 rpsR Small ribosomal subunit protein bS18 Maricaulis maris (strain MCS10)
A3DHF8 1.01e-23 88 60 0 65 3 rpsR Small ribosomal subunit protein bS18 Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)
Q5FU58 1.07e-23 88 58 0 68 3 rpsR Small ribosomal subunit protein bS18 Gluconobacter oxydans (strain 621H)
A7IK06 1.25e-23 88 58 0 70 3 rpsR Small ribosomal subunit protein bS18 Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)
Q0BPY9 1.3e-23 88 59 0 67 3 rpsR Small ribosomal subunit protein bS18 Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)
Q984T9 1.5e-23 87 60 0 70 3 rpsR Small ribosomal subunit protein bS18 Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099)
P66454 1.55e-23 87 60 0 68 3 rpsR Small ribosomal subunit protein bS18 Brucella suis biovar 1 (strain 1330)
A5VP26 1.55e-23 87 60 0 68 3 rpsR Small ribosomal subunit protein bS18 Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
P66453 1.55e-23 87 60 0 68 3 rpsR Small ribosomal subunit protein bS18 Brucella melitensis biotype 1 (strain ATCC 23456 / CCUG 17765 / NCTC 10094 / 16M)
C0RHG1 1.55e-23 87 60 0 68 3 rpsR Small ribosomal subunit protein bS18 Brucella melitensis biotype 2 (strain ATCC 23457)
A9M8X7 1.55e-23 87 60 0 68 3 rpsR Small ribosomal subunit protein bS18 Brucella canis (strain ATCC 23365 / NCTC 10854 / RM-666)
Q57ER3 1.55e-23 87 60 0 68 3 rpsR Small ribosomal subunit protein bS18 Brucella abortus biovar 1 (strain 9-941)
Q2YMH0 1.55e-23 87 60 0 68 3 rpsR Small ribosomal subunit protein bS18 Brucella abortus (strain 2308)
B2S9V3 1.55e-23 87 60 0 68 3 rpsR Small ribosomal subunit protein bS18 Brucella abortus (strain S19)
B2A454 2.07e-23 87 60 0 71 3 rpsR Small ribosomal subunit protein bS18 Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF)
Q6AK01 2.22e-23 87 52 0 73 3 rpsR Small ribosomal subunit protein bS18 Desulfotalea psychrophila (strain LSv54 / DSM 12343)
B9JUU1 2.36e-23 87 60 0 68 3 rpsR Small ribosomal subunit protein bS18 Allorhizobium ampelinum (strain ATCC BAA-846 / DSM 112012 / S4)
A8ZRQ2 2.45e-23 87 56 0 71 3 rpsR Small ribosomal subunit protein bS18 Desulfosudis oleivorans (strain DSM 6200 / JCM 39069 / Hxd3)
Q6G061 2.75e-23 87 61 0 68 3 rpsR Small ribosomal subunit protein bS18 Bartonella quintana (strain Toulouse)
Q2RXC7 2.87e-23 87 65 0 63 3 rpsR Small ribosomal subunit protein bS18 Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1)
Q6G447 3.06e-23 87 61 0 68 3 rpsR Small ribosomal subunit protein bS18 Bartonella henselae (strain ATCC 49882 / DSM 28221 / CCUG 30454 / Houston 1)
A9H1M6 3.18e-23 87 58 0 67 3 rpsR Small ribosomal subunit protein bS18 Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / CCUG 37298 / CIP 103539 / LMG 7603 / PAl5)
Q8UGE8 3.38e-23 86 60 0 68 3 rpsR Small ribosomal subunit protein bS18 Agrobacterium fabrum (strain C58 / ATCC 33970)
Q6MAT4 3.94e-23 86 60 0 66 3 rpsR Small ribosomal subunit protein bS18 Protochlamydia amoebophila (strain UWE25)
A9IRU1 4.21e-23 86 61 0 68 3 rpsR Small ribosomal subunit protein bS18 Bartonella tribocorum (strain CIP 105476 / IBS 506)
Q2KA94 5.48e-23 86 60 0 68 3 rpsR Small ribosomal subunit protein bS18 Rhizobium etli (strain ATCC 51251 / DSM 11541 / JCM 21823 / NBRC 15573 / CFN 42)
B3PUT6 5.48e-23 86 60 0 68 3 rpsR Small ribosomal subunit protein bS18 Rhizobium etli (strain CIAT 652)
C3M9B0 5.54e-23 86 60 0 68 3 rpsR Small ribosomal subunit protein bS18 Sinorhizobium fredii (strain NBRC 101917 / NGR234)
B9JCB8 5.54e-23 86 60 0 68 3 rpsR Small ribosomal subunit protein bS18 Rhizobium rhizogenes (strain K84 / ATCC BAA-868)
Q0SPR8 6.18e-23 86 60 0 65 3 rpsR Small ribosomal subunit protein bS18 Clostridium perfringens (strain SM101 / Type A)
Q8XH45 6.18e-23 86 60 0 65 3 rpsR Small ribosomal subunit protein bS18 Clostridium perfringens (strain 13 / Type A)
Q0TM10 6.18e-23 86 60 0 65 3 rpsR Small ribosomal subunit protein bS18 Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A)
B5ZWC8 6.25e-23 86 60 0 68 3 rpsR Small ribosomal subunit protein bS18 Rhizobium leguminosarum bv. trifolii (strain WSM2304)
Q1MJ11 6.25e-23 86 60 0 68 3 rpsR Small ribosomal subunit protein bS18 Rhizobium johnstonii (strain DSM 114642 / LMG 32736 / 3841)
A6U7G6 7.36e-23 85 61 0 67 3 rpsR Small ribosomal subunit protein bS18 Sinorhizobium medicae (strain WSM419)
Q92QZ8 7.36e-23 85 61 0 67 3 rpsR Small ribosomal subunit protein bS18 Rhizobium meliloti (strain 1021)
B0CKD8 9.17e-23 85 58 0 68 3 rpsR Small ribosomal subunit protein bS18 Brucella suis (strain ATCC 23445 / NCTC 10510)
B5YEW7 1.12e-22 85 54 0 68 3 rpsR Small ribosomal subunit protein bS18 Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12)
B1KU95 1.25e-22 85 58 0 65 3 rpsR Small ribosomal subunit protein bS18 Clostridium botulinum (strain Loch Maree / Type A3)
A7GJM2 1.25e-22 85 58 0 65 3 rpsR Small ribosomal subunit protein bS18 Clostridium botulinum (strain Langeland / NCTC 10281 / Type F)
B1IHQ2 1.25e-22 85 58 0 65 3 rpsR Small ribosomal subunit protein bS18 Clostridium botulinum (strain Okra / Type B1)
C1FP14 1.25e-22 85 58 0 65 3 rpsR Small ribosomal subunit protein bS18 Clostridium botulinum (strain Kyoto / Type A2)
A5I7Z9 1.25e-22 85 58 0 65 3 rpsR Small ribosomal subunit protein bS18 Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A)
C3KWH8 1.25e-22 85 58 0 65 3 rpsR Small ribosomal subunit protein bS18 Clostridium botulinum (strain 657 / Type Ba4)
A7FZG9 1.25e-22 85 58 0 65 3 rpsR Small ribosomal subunit protein bS18 Clostridium botulinum (strain ATCC 19397 / Type A)
Q8R6M3 1.41e-22 85 61 0 62 3 rpsR Small ribosomal subunit protein bS18 Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)
C0ZA45 1.44e-22 85 58 0 70 3 rpsR Small ribosomal subunit protein bS18 Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Q28RX4 1.55e-22 85 61 0 68 3 rpsR Small ribosomal subunit protein bS18 Jannaschia sp. (strain CCS1)
A0AEM3 1.63e-22 85 56 0 64 3 rpsR Small ribosomal subunit protein bS18 Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / CCUG 15529 / CIP 8149 / NCTC 11857 / SLCC 5334 / V8)
P66461 1.63e-22 85 56 0 64 1 rpsR Small ribosomal subunit protein bS18 Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
B8DAM0 1.63e-22 85 56 0 64 3 rpsR Small ribosomal subunit protein bS18 Listeria monocytogenes serotype 4a (strain HCC23)
Q725B8 1.63e-22 85 56 0 64 3 rpsR Small ribosomal subunit protein bS18 Listeria monocytogenes serotype 4b (strain F2365)
C1KV87 1.63e-22 85 56 0 64 3 rpsR Small ribosomal subunit protein bS18 Listeria monocytogenes serotype 4b (strain CLIP80459)
P66462 1.63e-22 85 56 0 64 3 rpsR Small ribosomal subunit protein bS18 Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)
Q0C084 1.78e-22 85 59 0 67 3 rpsR Small ribosomal subunit protein bS18 Hyphomonas neptunium (strain ATCC 15444)
Q8EKV5 2.81e-22 84 62 0 61 3 rpsR Small ribosomal subunit protein bS18 Oceanobacillus iheyensis (strain DSM 14371 / CIP 107618 / JCM 11309 / KCTC 3954 / HTE831)
B3E6H4 3.5e-22 85 58 0 72 3 rpsR Small ribosomal subunit protein bS18 Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ)
A7HYI3 3.67e-22 84 61 0 63 3 rpsR Small ribosomal subunit protein bS18 Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)
A0LAG7 3.95e-22 84 59 0 67 3 rpsR Small ribosomal subunit protein bS18 Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1)
B0K5L7 3.97e-22 84 59 0 62 3 rpsR Small ribosomal subunit protein bS18 Thermoanaerobacter sp. (strain X514)
B0K8G2 3.97e-22 84 59 0 62 3 rpsR Small ribosomal subunit protein bS18 Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E)
A4ITV8 4.31e-22 84 62 0 61 3 rpsR Small ribosomal subunit protein bS18 Geobacillus thermodenitrificans (strain NG80-2)
P10806 4.31e-22 84 62 0 61 1 rpsR Small ribosomal subunit protein bS18 Geobacillus stearothermophilus
Q5KU71 4.31e-22 84 62 0 61 3 rpsR Small ribosomal subunit protein bS18 Geobacillus kaustophilus (strain HTA426)
Q65CP5 5.75e-22 83 60 0 61 3 rpsR Small ribosomal subunit protein bS18 Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46)
P21475 6.56e-22 83 59 0 61 1 rpsR Small ribosomal subunit protein bS18 Bacillus subtilis (strain 168)
Q3Z7N9 6.69e-22 85 55 0 72 3 rpsR Small ribosomal subunit protein bS18 Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195)
Q3ZY14 8.23e-22 85 55 0 72 3 rpsR Small ribosomal subunit protein bS18 Dehalococcoides mccartyi (strain CBDB1)
A5FQL1 8.23e-22 85 55 0 72 3 rpsR Small ribosomal subunit protein bS18 Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1)
B1ZFQ7 8.56e-22 83 60 0 63 3 rpsR Small ribosomal subunit protein bS18 Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001)
A9W8G3 8.56e-22 83 60 0 63 3 rpsR Small ribosomal subunit protein bS18 Methylorubrum extorquens (strain PA1)
B7L2P1 8.56e-22 83 60 0 63 3 rpsR Small ribosomal subunit protein bS18 Methylorubrum extorquens (strain CM4 / NCIMB 13688)
B8E0J0 9.04e-22 83 52 0 68 3 rpsR Small ribosomal subunit protein bS18 Dictyoglomus turgidum (strain DSM 6724 / Z-1310)
A9NEP1 9.37e-22 83 57 0 66 3 rpsR Small ribosomal subunit protein bS18 Acholeplasma laidlawii (strain PG-8A)
A5G7R2 1.64e-21 82 54 0 72 3 rpsR Small ribosomal subunit protein bS18 Geotalea uraniireducens (strain Rf4)
A4YT76 2.14e-21 82 61 0 65 3 rpsR Small ribosomal subunit protein bS18 Bradyrhizobium sp. (strain ORS 278)
A5EI97 2.14e-21 82 61 0 65 3 rpsR Small ribosomal subunit protein bS18 Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)
B9M5U9 2.48e-21 82 54 0 72 3 rpsR Small ribosomal subunit protein bS18 Geotalea daltonii (strain DSM 22248 / JCM 15807 / FRC-32)
A1AM19 2.49e-21 82 55 0 72 3 rpsR Small ribosomal subunit protein bS18 Pelobacter propionicus (strain DSM 2379 / NBRC 103807 / OttBd1)
Q97CX4 2.91e-21 82 56 0 65 3 rpsR Small ribosomal subunit protein bS18 Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / IAM 19013 / LMG 5710 / NBRC 13948 / NRRL B-527 / VKM B-1787 / 2291 / W)
Q01QR5 3.05e-21 82 50 0 69 3 rpsR Small ribosomal subunit protein bS18 Solibacter usitatus (strain Ellin6076)
A5N438 3.08e-21 82 56 0 65 3 rpsR Small ribosomal subunit protein bS18 Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680)
B9DXQ8 3.08e-21 82 56 0 65 3 rpsR Small ribosomal subunit protein bS18 Clostridium kluyveri (strain NBRC 12016)
B1LYI3 3.24e-21 81 60 0 63 3 rpsR Small ribosomal subunit protein bS18 Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
A7ZAU7 3.4e-21 81 57 0 61 3 rpsR Small ribosomal subunit protein bS18 Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / LMG 26770 / FZB42)
Q2RM70 3.48e-21 81 56 0 62 3 rpsR Small ribosomal subunit protein bS18 Moorella thermoacetica (strain ATCC 39073 / JCM 9320)
Q6YRK3 4.47e-21 81 55 0 65 3 rpsR Small ribosomal subunit protein bS18 Onion yellows phytoplasma (strain OY-M)
Q2LUJ7 4.57e-21 81 52 0 69 3 rpsR Small ribosomal subunit protein bS18 Syntrophus aciditrophicus (strain SB)
Q9Z6V4 5.4e-21 81 53 1 69 3 rpsR Small ribosomal subunit protein bS18 Chlamydia pneumoniae
A8FJE5 5.56e-21 81 55 0 61 3 rpsR Small ribosomal subunit protein bS18 Bacillus pumilus (strain SAFR-032)
P24286 5.74e-21 81 53 1 69 3 rpsR Small ribosomal subunit protein bS18 Chlamydia muridarum (strain MoPn / Nigg)
B8IED1 5.96e-21 81 58 0 65 3 rpsR Small ribosomal subunit protein bS18 Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)
A4XJ54 6.03e-21 81 52 0 69 3 rpsR Small ribosomal subunit protein bS18 Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331)
B7J146 6.18e-21 81 59 1 67 3 rpsR Small ribosomal subunit protein bS18 Borreliella burgdorferi (strain ZS7)
O51140 6.18e-21 81 59 1 67 1 rpsR Small ribosomal subunit protein bS18 Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31)
B0UL30 6.19e-21 81 58 0 65 3 rpsR Small ribosomal subunit protein bS18 Methylobacterium sp. (strain 4-46)
B2IHD2 6.51e-21 80 61 0 65 3 rpsR Small ribosomal subunit protein bS18 Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIMB 8712)
O84808 6.62e-21 80 53 1 69 3 rpsR Small ribosomal subunit protein bS18 Chlamydia trachomatis serovar D (strain ATCC VR-885 / DSM 19411 / UW-3/Cx)
B0BAQ8 6.62e-21 80 53 1 69 3 rpsR Small ribosomal subunit protein bS18 Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)
Q3KKN9 6.62e-21 80 53 1 69 3 rpsR Small ribosomal subunit protein bS18 Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13)
B0B929 6.62e-21 80 53 1 69 3 rpsR Small ribosomal subunit protein bS18 Chlamydia trachomatis serovar L2 (strain ATCC VR-902B / DSM 19102 / 434/Bu)
B8ESH9 6.88e-21 80 61 0 65 3 rpsR Small ribosomal subunit protein bS18 Methylocella silvestris (strain DSM 15510 / CIP 108128 / LMG 27833 / NCIMB 13906 / BL2)
Q662P9 8.77e-21 81 58 1 67 3 rpsR Small ribosomal subunit protein bS18 Borrelia garinii subsp. bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi)
Q39RR3 8.81e-21 81 52 0 72 3 rpsR Small ribosomal subunit protein bS18 Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15)
Q3AG25 1.08e-20 80 51 0 66 3 rpsR Small ribosomal subunit protein bS18 Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)
A6M3L0 1.11e-20 80 55 0 65 3 rpsR Small ribosomal subunit protein bS18 Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052)
B5Y876 1.24e-20 80 53 0 66 3 rpsR Small ribosomal subunit protein bS18 Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / OCM 4 / BT)
C6E504 1.29e-20 80 51 0 72 3 rpsR Small ribosomal subunit protein bS18 Geobacter sp. (strain M21)
B5EHW8 1.29e-20 80 51 0 72 3 rpsR Small ribosomal subunit protein bS18 Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem)
Q2NKC1 1.37e-20 80 53 0 65 3 rpsR Small ribosomal subunit protein bS18 Aster yellows witches'-broom phytoplasma (strain AYWB)
Q67J50 1.55e-20 79 57 0 61 3 rpsR Small ribosomal subunit protein bS18 Symbiobacterium thermophilum (strain DSM 24528 / JCM 14929 / IAM 14863 / T)
Q1IHW4 1.59e-20 81 50 0 68 3 rpsR Small ribosomal subunit protein bS18 Koribacter versatilis (strain Ellin345)
Q74FE3 1.87e-20 80 51 0 72 3 rpsR Small ribosomal subunit protein bS18 Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA)
A8MED6 2.13e-20 79 56 0 62 3 rpsR Small ribosomal subunit protein bS18 Alkaliphilus oremlandii (strain OhILAs)
Q73M34 2.2e-20 79 57 1 70 3 rpsR Small ribosomal subunit protein bS18 Treponema denticola (strain ATCC 35405 / DSM 14222 / CIP 103919 / JCM 8153 / KCTC 15104)
A5FE76 2.61e-20 80 51 0 66 3 rpsR Small ribosomal subunit protein bS18 Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / BCRC 14874 / CCUG 350202 / NBRC 14942 / NCIMB 11054 / UW101)
A0LN58 3.03e-20 79 53 0 67 3 rpsR Small ribosomal subunit protein bS18 Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB)
Q0SP51 3.29e-20 79 58 1 67 3 rpsR Small ribosomal subunit protein bS18 Borreliella afzelii (strain PKo)
Q11RW9 3.94e-20 79 53 0 65 3 rpsR Small ribosomal subunit protein bS18 Cytophaga hutchinsonii (strain ATCC 33406 / DSM 1761 / CIP 103989 / NBRC 15051 / NCIMB 9469 / D465)
A9B461 5.25e-20 79 57 1 69 3 rpsR Small ribosomal subunit protein bS18 Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785 / 114-95)
B0TE71 5.99e-20 78 51 0 62 3 rpsR Small ribosomal subunit protein bS18 Heliobacterium modesticaldum (strain ATCC 51547 / Ice1)
C1F903 6.55e-20 79 45 0 72 3 rpsR Small ribosomal subunit protein bS18 Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161)
B1H013 6.98e-20 79 56 1 65 3 rpsR Small ribosomal subunit protein bS18 Endomicrobium trichonymphae
A0M0D8 7.84e-20 79 51 0 64 3 rpsR Small ribosomal subunit protein bS18 Christiangramia forsetii (strain DSM 17595 / CGMCC 1.15422 / KT0803)
Q8F5K4 8.13e-20 78 57 1 66 3 rpsR Small ribosomal subunit protein bS18 Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601)
Q72QK2 8.13e-20 78 57 1 66 3 rpsR Small ribosomal subunit protein bS18 Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130)
Q052K0 8.13e-20 78 57 1 66 3 rpsR Small ribosomal subunit protein bS18 Leptospira borgpetersenii serovar Hardjo-bovis (strain L550)
Q04TH1 8.13e-20 78 57 1 66 3 rpsR Small ribosomal subunit protein bS18 Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197)
Q8RIE4 8.43e-20 77 52 1 71 3 rpsR Small ribosomal subunit protein bS18 Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / DSM 15643 / BCRC 10681 / CIP 101130 / JCM 8532 / KCTC 2640 / LMG 13131 / VPI 4355)
Q1D290 9.65e-20 79 59 0 61 3 rpsR Small ribosomal subunit protein bS18 Myxococcus xanthus (strain DK1622)
Q24MB9 1.01e-19 77 55 0 61 3 rpsR Small ribosomal subunit protein bS18 Desulfitobacterium hafniense (strain Y51)
A5CY50 1.07e-19 77 52 0 65 3 rpsR Small ribosomal subunit protein bS18 Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI)
A6H0P2 1.07e-19 78 50 0 66 3 rpsR Small ribosomal subunit protein bS18 Flavobacterium psychrophilum (strain ATCC 49511 / DSM 21280 / CIP 103535 / JIP02/86)
Q821W8 1.27e-19 77 54 1 68 3 rpsR Small ribosomal subunit protein bS18 Chlamydia caviae (strain ATCC VR-813 / DSM 19441 / 03DC25 / GPIC)
C0R078 1.4e-19 78 48 0 70 3 rpsR Small ribosomal subunit protein bS18 Brachyspira hyodysenteriae (strain ATCC 49526 / WA1)
Q3A318 1.49e-19 77 53 0 67 3 rpsR Small ribosomal subunit protein bS18 Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1)
B2KEG0 2.04e-19 78 49 0 69 3 rpsR Small ribosomal subunit protein bS18 Elusimicrobium minutum (strain Pei191)
A0PX89 2.22e-19 77 55 0 61 3 rpsR Small ribosomal subunit protein bS18 Clostridium novyi (strain NT)
A1VF29 2.55e-19 77 57 0 68 3 rpsR Small ribosomal subunit protein bS18 Nitratidesulfovibrio vulgaris (strain DP4)
Q72DH2 2.55e-19 77 57 0 68 3 rpsR Small ribosomal subunit protein bS18 Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough)
A9KKC8 2.96e-19 76 55 1 63 3 rpsR Small ribosomal subunit protein bS18 Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)
B8J802 3.18e-19 78 53 0 63 3 rpsR Small ribosomal subunit protein bS18 Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258)
B4ULC0 3.34e-19 78 53 0 63 3 rpsR Small ribosomal subunit protein bS18 Anaeromyxobacter sp. (strain K)
Q02VU1 3.56e-19 76 51 1 72 3 rpsR Small ribosomal subunit protein bS18 Lactococcus lactis subsp. cremoris (strain SK11)
A2RNZ2 3.56e-19 76 51 1 72 1 rpsR Small ribosomal subunit protein bS18 Lactococcus lactis subsp. cremoris (strain MG1363)
Q9CDN0 3.56e-19 76 51 1 72 3 rpsR Small ribosomal subunit protein bS18 Lactococcus lactis subsp. lactis (strain IL1403)
Q2IM64 4.33e-19 77 53 0 63 3 rpsR Small ribosomal subunit protein bS18 Anaeromyxobacter dehalogenans (strain 2CP-C)
B5ZC59 5.13e-19 76 47 0 65 3 rpsR Small ribosomal subunit protein bS18 Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western)
Q9PPT8 5.42e-19 76 47 0 65 3 rpsR Small ribosomal subunit protein bS18 Ureaplasma parvum serovar 3 (strain ATCC 700970)
B1AJJ2 5.42e-19 76 47 0 65 3 rpsR Small ribosomal subunit protein bS18 Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736)
Q181R4 5.62e-19 75 58 0 62 3 rpsR Small ribosomal subunit protein bS18 Clostridioides difficile (strain 630)
Q5L566 6.76e-19 76 52 1 69 3 rpsR Small ribosomal subunit protein bS18 Chlamydia abortus (strain DSM 27085 / S26/3)
A7H6J3 7.29e-19 77 52 0 63 3 rpsR Small ribosomal subunit protein bS18 Anaeromyxobacter sp. (strain Fw109-5)
B8G975 8.19e-19 75 54 1 74 3 rpsR Small ribosomal subunit protein bS18 Chloroflexus aggregans (strain MD-66 / DSM 9485)
Q255R9 1.06e-18 75 52 1 69 3 rpsR Small ribosomal subunit protein bS18 Chlamydia felis (strain Fe/C-56)
A7NJF1 1.35e-18 75 48 0 68 3 rpsR1 Small ribosomal subunit protein bS18A Roseiflexus castenholzii (strain DSM 13941 / HLO8)
B8DRL3 1.75e-18 75 55 0 68 3 rpsR Small ribosomal subunit protein bS18 Nitratidesulfovibrio vulgaris (strain DSM 19637 / Miyazaki F)
A0T0R4 1.83e-18 74 61 0 57 3 rps18 Small ribosomal subunit protein bS18c Thalassiosira pseudonana
A6TJA9 1.99e-18 74 51 0 62 3 rpsR Small ribosomal subunit protein bS18 Alkaliphilus metalliredigens (strain QYMF)
B9LER9 2.27e-18 74 55 1 68 3 rpsR Small ribosomal subunit protein bS18 Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl)
A9WCD9 2.27e-18 74 55 1 68 3 rpsR Small ribosomal subunit protein bS18 Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
Q5HU32 2.42e-18 74 52 1 69 3 rpsR Small ribosomal subunit protein bS18 Campylobacter jejuni (strain RM1221)
A1W059 2.42e-18 74 52 1 69 3 rpsR Small ribosomal subunit protein bS18 Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176)
O69301 2.42e-18 74 52 1 69 3 rpsR Small ribosomal subunit protein bS18 Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)
A7H2T2 2.42e-18 74 52 1 69 3 rpsR Small ribosomal subunit protein bS18 Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97)
A8FMC5 2.42e-18 74 52 1 69 3 rpsR Small ribosomal subunit protein bS18 Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828)

  • Number of RefSeq hits:

General

Source Morganella morganii S4
Locus tag NLDBIP_13365
Feature type CDS
Gene rpsR
Product 30S ribosomal protein S18
Location 81643 - 81870 (strand: -1)
Length 228 (nucleotides) / 75 (amino acids)
In genomic island -

Contig

Accession ZDB_528
Length 162442 nucleotides
Topology linear
Plasmid False

Orthology

Orthogroup group_1430
Orthogroup size 7
N. genomes 7

Actions

Genomic region

Domains

PF01084 Ribosomal protein S18

COG entry Annotation(s)

ID Function(s) descr. Function(s) cat. Description
COG0238 Translation, ribosomal structure and biogenesis (J) J Ribosomal protein S18

Kegg Ortholog Annotation(s)

KO Description Pathways Modules
K02963 small subunit ribosomal protein S18 Ribosome -

Protein Sequence

MARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTSAKYQRQLARAIKRARYLSLLPYTDRHQ

Flanking regions ( +/- flanking 50bp)

GGTTCTTCATGCCGAACATATTGAATTGATAGATTCTGGAGACTAGCCATATGGCACGTTATTTCCGTCGTCGTAAATTCTGCCGTTTCACCGCAGAAGGCGTTCAAGAGATTGATTATAAAGACATCGCTACGCTGAAAAACTACATCACTGAAAGTGGTAAAATCGTACCAAGCCGTATCACCGGTACCAGTGCGAAATATCAGCGTCAGCTCGCTCGTGCTATCAAGCGTGCACGCTACCTGTCTTTACTGCCTTACACTGATCGTCATCAGTAATCGGCACAGTCCATTAATGACTTTAAGAGGATAAGGTAATGCAAGTTATT